SecReT4
Protein ID: 163856528
T4SS name [ID]Trb [349]
Gene symboltrbI1
Locus tagBpet2215
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]2295911..2297191 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDA9IL99
KEGG IDbpt:Bpet2215
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-57, Aligned region: 230..412
Protein Sequence: 426 a.a.     [Download]
>gi|163856528|ref|YP_001630826.1| trbI1 gene product [Bordetella petrii DSM 12804]
MSQDDTPDLATPQAGKVAPETVALRAQPRAVTRLNRRTLAVLVGSLSVAVLGATIWSLQPQRRGAGEQTE
LYNVDRVSKSEGLDGLPADYSKLPQKVPELGPPLPGDLGPAIVNSQQPAVAAYAAPGHDPNDALRKEAEA
AAASSVFFRSAGQGQAAATTTMAQTAPGVPGAANTLAAFDPLAAGPASAAAQLAAPTAARSRQDQNEAFL
QSGSTETRNSGHLALPASPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDSATGKFLLIPQGSRIL
GRYNSRVSHGQSRVQVVWNRVILPDTSSLTLDNLIGTDPAGYSGLEDDVDWHWDRVVAGAVLTTLLGVGA
ELAAPENRQDGNRIVIAGRDSAQDSINQVGQEITRRNMDIQPTLTIRPGLPVRVIVNRDLVLRPYQPLFF
NRGASQ
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2295911-2297191 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAGCCAGGACGACACTCCCGACCTCGCCACGCCGCAGGCAGGCAAGGTCGCGCCCGAGACGGTGGCGC
TTCGTGCCCAGCCGCGTGCTGTGACCCGGTTGAACCGGCGCACGCTGGCCGTCCTCGTCGGTAGCCTGTC
GGTCGCCGTGCTCGGGGCCACGATCTGGTCACTGCAACCGCAGCGGCGTGGCGCGGGCGAGCAGACCGAG
CTTTACAACGTCGATCGCGTCTCGAAGTCCGAAGGGCTGGACGGCCTGCCGGCCGACTACTCGAAGCTGC
CGCAGAAGGTGCCCGAGCTGGGGCCGCCACTGCCGGGCGATCTTGGCCCGGCCATCGTGAACTCGCAGCA
GCCGGCCGTGGCCGCTTACGCGGCCCCCGGCCACGATCCGAACGATGCCTTGCGCAAGGAAGCGGAAGCC
GCAGCGGCTTCGTCGGTGTTCTTCCGCTCGGCCGGCCAGGGTCAGGCCGCCGCCACGACCACGATGGCGC
AGACGGCGCCGGGTGTGCCCGGTGCTGCCAACACGCTCGCGGCCTTCGATCCGCTCGCGGCTGGGCCAGC
CTCGGCGGCGGCCCAGCTTGCCGCCCCGACTGCGGCACGGAGTCGGCAAGACCAGAACGAGGCATTCCTG
CAAAGCGGCTCTACGGAAACCCGCAATTCCGGCCATCTGGCACTGCCGGCATCGCCGTATCAGGTCATGG
CCGGGACGGTGATCGCGGGCGCGCTGGTGACAGGCATCAAGTCGGACTTGCCGGGCGACGTGATCGCCAC
GGTGACGGAGCCGGTCTATGACTCGGCCACGGGCAAGTTTCTGCTGATCCCGCAGGGCTCGCGCATCCTC
GGGCGCTACAACAGCCGGGTCAGCCACGGGCAGAGCCGCGTGCAGGTGGTGTGGAATCGGGTCATCCTGC
CCGACACGTCTTCGCTGACACTCGACAACCTCATCGGCACCGACCCGGCCGGTTACTCCGGCCTGGAGGA
TGACGTGGACTGGCATTGGGATCGCGTCGTCGCGGGCGCGGTGCTGACGACGTTGCTGGGCGTCGGTGCC
GAGCTGGCCGCGCCCGAGAACCGCCAGGACGGCAACCGCATCGTCATCGCCGGGCGCGACAGCGCCCAGG
ACAGCATCAATCAGGTCGGCCAGGAGATTACCCGGCGCAACATGGACATCCAGCCGACGCTGACCATCAG
GCCCGGCCTGCCGGTTCGCGTCATCGTCAACCGGGATCTGGTGCTGCGGCCCTACCAGCCGCTGTTCTTC
AACCGGGGGGCTTCGCAATGA
 Primer design