SecReT4
Protein ID: 163858015
T4SS name [ID]Trw [134]
Gene symbolvirB1
Locus tagBpet3702
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3914973..3915638 [+]
Producttype IV secretion system protein VirB1
Component typeTrwN
UniProt IDA9I2C8
KEGG IDbpt:Bpet3702
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 2.4e-21, Aligned region: 8..149
Protein Sequence: 221 a.a.     [Download]
>gi|163858015|ref|YP_001632313.1| virB1 gene product [Bordetella petrii DSM 12804]
MIAELAALALTCAPNIHPVTLHALIRHESRVRQYAIGVNRKGQHLRRQPQTLIEASAAADRLIDQGIDFD
AGLGQINVRNWAWLNLDSKTVFDPCRNLAAAQTVLAECYARALPQQTDPQHALRAALSCYNTGNFKRGFT
NGYVGKVLAQAKIKVPALAPLKNEMTGPATKATPAEPAQKPDQGPPAQPEGAPDGFSANPATDGFSQTRD
GEPESSANSDA
 
Nucleotide Sequence: 666 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3914973-3915638 Bordetella petrii DSM 12804 chromosome, complete genome
ATGATCGCAGAACTTGCAGCGTTGGCCCTCACCTGCGCACCCAACATCCACCCAGTCACCCTGCATGCAC
TGATTCGTCATGAATCCCGAGTCCGGCAGTACGCCATCGGCGTCAACCGCAAGGGCCAGCACCTTCGACG
GCAACCTCAAACCTTGATCGAAGCGAGCGCAGCTGCTGACCGCCTCATTGACCAGGGTATCGACTTCGAT
GCCGGGCTGGGGCAGATCAATGTTCGCAACTGGGCATGGTTGAACCTCGATAGCAAGACCGTCTTTGATC
CGTGCCGCAACTTGGCCGCCGCCCAGACGGTACTGGCAGAGTGCTACGCCAGAGCATTACCCCAACAGAC
GGATCCGCAGCATGCCTTACGCGCCGCGCTGTCCTGCTACAACACCGGCAATTTCAAGCGTGGTTTCACC
AATGGCTATGTCGGCAAAGTGCTGGCCCAAGCCAAGATCAAGGTTCCGGCCCTGGCACCGTTGAAAAACG
AAATGACAGGGCCTGCGACAAAGGCCACGCCGGCAGAGCCAGCGCAGAAACCCGATCAAGGACCACCGGC
TCAACCAGAAGGCGCACCGGACGGTTTCAGCGCCAACCCGGCAACCGACGGCTTTTCACAAACGCGTGAT
GGCGAACCAGAAAGCAGCGCTAACTCCGACGCCTGA
 Primer design