SecReT4
Protein ID: 163858016
T4SS name [ID]Trw [134]
Gene symboltrwL
Locus tagBpet3703
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3915729..3916049 [+]
Productconjugal transfer protein TrwL
Component typeTrwL
UniProt IDA9I2D1
KEGG IDbpt:Bpet3703
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-08, Aligned region: 14..101
Protein Sequence: 106 a.a.     [Download]
>gi|163858016|ref|YP_001632314.1| trwL gene product [Bordetella petrii DSM 12804]
MSLLKHFKNAMSYLRIINKPTTAALLLGIHQVAFAQSIGGLSRAQTTLQTLRDNLDVILPIAAIIIGVII
FVLYSAEVMRKDDAIRWGIGVLLAGSVAELVVLLWK
 
Nucleotide Sequence: 321 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3915729-3916049 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCTCTACTGAAACACTTCAAGAACGCTATGTCCTACCTGCGCATCATCAACAAACCGACTACAGCCG
CACTGCTGCTTGGCATCCATCAAGTTGCATTTGCACAATCCATTGGCGGCCTTTCCCGAGCACAAACGAC
ATTACAGACTCTCAGAGACAATCTGGATGTCATCCTGCCCATTGCAGCCATCATCATCGGCGTCATCATT
TTTGTACTGTATTCCGCAGAGGTCATGCGTAAAGACGATGCCATCCGGTGGGGCATTGGCGTGCTGCTGG
CTGGATCAGTGGCCGAGCTGGTTGTGTTGCTTTGGAAGTAA
 Primer design