SecReT4
Protein ID: 163858021
T4SS name [ID]Trw [134]
Gene symbolvirB5
Locus tagBpet3708
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3920011..3920715 [+]
Producttype IV secretion system protein VirB5
Component typeTrwJ
UniProt IDA9I2E7
KEGG IDbpt:Bpet3708
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.2e-37, Aligned region: 25..212
OmpH [PF03938], Evalue: 1e-05, Aligned region: 15..195
Protein Sequence: 234 a.a.     [Download]
>gi|163858021|ref|YP_001632319.1| virB5 gene product [Bordetella petrii DSM 12804]
MTRCKSFAAGIVLSAVFLNPVQASGIPTVDAATIAQLQEQLLTARDQLKNLTEQLATAKSQLAAFTQSSG
FGNVVGSPDMRDQLRSALPSNAQGLLDRSNGSSLDGDVGRVTDSVMAPVNFEADRAELSKKALNIEATAK
AMSQRAYDSMTQRLANVDALQDKINQTTNPKEISELQARIQIEQANILTEQTRIQLASQQLEAERHLLQA
RAERVYGGWFGDNDTAGVKAGSNE
 
Nucleotide Sequence: 705 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3920011-3920715 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACACGCTGCAAGTCGTTTGCGGCGGGCATTGTCCTGTCCGCCGTTTTCTTAAACCCTGTCCAAGCTA
GCGGCATCCCTACGGTCGATGCTGCCACCATTGCGCAGTTACAGGAGCAATTGCTCACTGCCAGAGACCA
ACTGAAGAATCTGACCGAACAGCTGGCCACCGCCAAAAGCCAACTCGCCGCATTCACACAATCCAGTGGT
TTCGGAAATGTAGTCGGCAGTCCTGACATGCGTGACCAGTTGCGTTCAGCTCTGCCTTCGAATGCCCAAG
GGCTACTTGATCGCTCAAACGGCTCAAGCCTGGATGGCGACGTTGGCCGCGTTACCGACTCGGTCATGGC
CCCGGTAAATTTTGAAGCGGATCGTGCAGAACTTTCAAAGAAGGCGTTGAACATCGAAGCGACCGCCAAG
GCCATGAGTCAACGAGCCTACGACTCCATGACCCAACGTCTGGCCAATGTGGATGCACTGCAAGACAAGA
TCAATCAGACGACTAACCCCAAAGAGATATCCGAGCTACAGGCTCGAATCCAGATTGAGCAGGCCAATAT
CTTGACCGAGCAAACTCGCATTCAGCTAGCCTCCCAACAACTGGAGGCAGAGCGTCACCTGCTACAAGCC
AGAGCAGAACGGGTATATGGTGGCTGGTTTGGGGATAACGATACTGCTGGCGTAAAGGCCGGCTCCAATG
AGTAA
 Primer design