SecReT4
Protein ID: 163858023
T4SS name [ID]Trw [134]
Gene symboltrwH
Locus tagBpet3710
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3921763..3921900 [+]
Productconjugal transfer protein TrwH
Component typeTrwH
UniProt IDA9I2F3
KEGG IDbpt:Bpet3710
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 45 a.a.     [Download]
>gi|163858023|ref|YP_001632321.1| trwH gene product [Bordetella petrii DSM 12804]
MKNLFAALALAGLLAGCAFHAPQPPQPADTPRVPVNATPPLFKGV
 
Nucleotide Sequence: 138 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3921763-3921900 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAAAACCTCTTTGCCGCCCTCGCGCTGGCCGGGCTGCTGGCTGGCTGCGCCTTTCATGCGCCCCAGC
CGCCGCAACCGGCCGATACGCCACGCGTGCCGGTCAATGCCACGCCGCCTCTTTTCAAAGGAGTTTGA
 Primer design