SecReT4
Protein ID: 163858024
T4SS name [ID]Trw [134]
Gene symbolvirB8
Locus tagBpet3711
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3921904..3922590 [+]
Producttype IV secretion system protein VirB8
Component typeTrwG
UniProt IDA9I2F6
KEGG IDbpt:Bpet3711
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-52, Aligned region: 17..222
Protein Sequence: 228 a.a.     [Download]
>gi|163858024|ref|YP_001632322.1| virB8 gene product [Bordetella petrii DSM 12804]
MSASLKSEDVAAYLEQSRGLERDHLGELVSSRKRAWQVAIGAGLIALASVAAVAGLTPLKQPPEMYVVRV
DSATGSIEHVSSLGQPLEDYGQRIAKYFLNTYVLNCEGYSWQTIQEQFDTCALLSSAPIQTQYGKRFEGQ
DAVTTRLGTQGTVDVQVHSITLGANQAAIVRFTKTEREVSTGNITKAQHLIATMAYQYTDVPLTEEVARL
NPLGFQVMRYDLAADLSR
 
Nucleotide Sequence: 687 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3921904-3922590 Bordetella petrii DSM 12804 chromosome, complete genome
GTGTCCGCATCACTTAAATCCGAAGACGTTGCCGCCTACCTGGAGCAGTCGCGCGGCCTGGAGCGCGATC
ACCTCGGCGAGCTCGTCAGCAGCCGTAAGCGTGCCTGGCAGGTAGCTATCGGTGCCGGCCTGATCGCTCT
GGCCTCCGTCGCTGCCGTTGCGGGCCTCACCCCTTTGAAGCAGCCACCCGAAATGTATGTGGTCCGCGTC
GATAGCGCCACCGGCTCCATCGAACATGTCAGCAGTCTGGGCCAGCCGCTCGAAGATTACGGCCAGCGCA
TCGCCAAGTATTTTCTGAACACTTACGTGCTGAACTGCGAGGGCTACAGTTGGCAGACGATACAGGAGCA
ATTCGACACGTGCGCGCTGCTGTCCTCTGCCCCCATCCAGACACAGTACGGCAAACGATTCGAAGGGCAG
GACGCCGTTACGACACGCCTCGGTACCCAGGGCACAGTCGATGTGCAGGTTCATTCGATCACATTGGGTG
CCAACCAGGCCGCCATCGTACGCTTTACCAAGACAGAGCGGGAAGTCTCCACGGGCAACATCACCAAGGC
TCAGCACCTGATTGCCACCATGGCGTATCAGTACACCGACGTGCCGCTCACCGAAGAGGTCGCCCGCCTG
AACCCGCTGGGCTTTCAGGTCATGCGCTATGACCTGGCTGCCGATCTGTCGCGCTGA
 Primer design