SecReT4
Protein ID: 163858025
T4SS name [ID]Trw [134]
Gene symbolvirB9
Locus tagBpet3712
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3922618..3923505 [+]
Producttype IV secretion system protein VirB9
Component typeTrwF
UniProt IDA9I2F9
KEGG IDbpt:Bpet3712
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.8e-59, Aligned region: 35..244
Protein Sequence: 295 a.a.     [Download]
>gi|163858025|ref|YP_001632323.1| virB9 gene product [Bordetella petrii DSM 12804]
MFKHFPSRQALALFLCLAIPASALALETPRSSRLDHRVRYVNYNDANVIQLNAVIGVATHIVLEPGEKYV
YHVFGDSQAYAFTYKNNHLFFKPTAEDANTNLIVVTDRRDYSFRLSYSDNRNSAALYKLVVRYPEVQARQ
RAQAAQKAAIERSLQAVSANMNWQAYTRSGDAAIAPVHAWDDGRQTWLQFAPQADIPTVYRVTPDGQEVI
TNHHMADERTMVLHRTSALWHLRLGDQVLAIHNDAYGTTPVPAHTGTASPAVRRSIKGSASPQSPAAAPV
PTIRIREATQERNSP
 
Nucleotide Sequence: 888 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3922618-3923505 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTTTAAACATTTCCCCAGTCGGCAGGCGCTGGCGTTGTTTCTTTGCCTGGCCATCCCTGCCAGCGCCC
TGGCGCTGGAGACCCCTCGTTCCTCGCGGCTCGACCACCGCGTACGCTATGTCAATTACAACGACGCCAA
TGTCATCCAGCTCAATGCCGTGATCGGCGTGGCCACCCATATCGTGCTGGAGCCCGGCGAAAAATACGTC
TACCACGTCTTTGGTGATAGCCAAGCCTACGCGTTTACCTACAAGAACAATCATCTGTTCTTCAAACCCA
CGGCAGAAGACGCCAACACCAACCTTATCGTCGTCACTGACAGGCGCGATTACAGCTTCAGGCTCTCGTA
CAGCGACAACCGCAATTCTGCCGCCCTGTACAAACTCGTGGTCCGTTATCCAGAGGTTCAAGCCAGGCAA
CGAGCCCAGGCCGCACAAAAAGCTGCGATTGAGCGATCCTTACAAGCCGTCAGCGCGAACATGAACTGGC
AGGCCTACACCCGCAGCGGCGACGCGGCCATCGCACCGGTACACGCCTGGGATGATGGCCGTCAGACTTG
GCTGCAGTTTGCACCGCAAGCCGACATCCCGACCGTGTACCGCGTCACGCCAGACGGCCAGGAAGTCATC
ACCAATCACCACATGGCAGATGAACGCACCATGGTGCTGCATCGCACGTCTGCCTTATGGCACCTTCGCC
TGGGCGACCAAGTGCTGGCGATTCACAACGACGCCTACGGCACCACACCCGTACCAGCACATACCGGGAC
GGCATCACCGGCAGTCAGACGCAGCATCAAGGGTAGTGCGAGCCCGCAATCGCCCGCTGCGGCACCTGTG
CCCACCATCCGCATACGCGAAGCCACGCAAGAAAGGAATTCCCCATGA
 Primer design