SecReT4
Protein ID: 163858026
T4SS name [ID]Trw [134]
Gene symbolvirB10
Locus tagBpet3713
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]3923502..3924635 [+]
Producttype IV secretion system protein VirB10
Component typeTrwE
UniProt IDA9I2G2
KEGG IDbpt:Bpet3713
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-57, Aligned region: 191..367
Protein Sequence: 377 a.a.     [Download]
>gi|163858026|ref|YP_001632324.1| virB10 gene product [Bordetella petrii DSM 12804]
MTEKEQDQAQAQASQEGNPKDANLERETLNLEATGRSAPRGARAFLWLTILIAVAVAAGVLMKVWSREPA
AKADSGLEADQSGITNRLKAPEVERPAPPPALPPPTPEPTVAPNYNVPSPMPAAPPPVDELTQRRLASPL
QAGGADASGATPSQSNGPQGPYSDAGPLADKLRPLELAPSVAGQLGDRNFLLTQGTMIDCTLQTKLVSTQ
SGLLTCLATHDVMSANGKVKLIDAGTKFTGYQSGGIQQGQARAFVTWNRLETPTGVIVNLSSPGTGPLGE
AGLGGHIDNHFWERFGNAILLSLVGDFGNWASNQGQSGSNNIRFDNTAEGGQEAVAKILEKSLDIPPTLY
KNQGERIGIMVARDLDFSHVYELEPIH
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|163854304|ref|NC_010170.1|:3923502-3924635 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGGAAAAGGAACAAGACCAGGCACAAGCACAAGCCTCACAAGAGGGGAATCCTAAAGACGCTAATC
TGGAGCGGGAAACACTGAATCTGGAAGCAACCGGGCGCAGCGCCCCACGCGGTGCCCGCGCATTTCTGTG
GCTCACCATTCTGATCGCTGTGGCAGTGGCTGCCGGCGTGCTCATGAAGGTCTGGAGCCGCGAACCAGCG
GCAAAAGCCGATAGCGGTCTGGAAGCCGATCAAAGCGGCATTACCAATCGCCTCAAAGCCCCCGAGGTAG
AGCGTCCCGCGCCACCTCCAGCACTGCCGCCTCCGACGCCCGAACCAACGGTGGCGCCCAACTACAACGT
CCCGTCACCCATGCCCGCAGCTCCGCCTCCCGTCGATGAGCTTACCCAGCGCCGGCTGGCCAGCCCGCTA
CAGGCGGGTGGCGCAGACGCAAGCGGCGCGACCCCAAGCCAGTCAAATGGCCCCCAAGGCCCTTATAGCG
ATGCTGGTCCCCTGGCCGACAAGCTGCGACCGCTGGAGCTGGCCCCATCGGTGGCCGGGCAACTGGGTGA
CCGCAACTTCCTGCTCACGCAAGGCACCATGATCGACTGCACCCTGCAGACCAAACTGGTCAGCACCCAG
TCCGGGCTCCTGACGTGTCTGGCCACGCACGATGTCATGAGCGCCAACGGCAAGGTCAAGCTCATTGATG
CCGGCACCAAGTTCACGGGCTATCAGTCTGGGGGCATACAGCAGGGCCAGGCGCGCGCCTTTGTGACATG
GAACCGGCTGGAAACGCCTACCGGGGTCATCGTGAACCTAAGTTCCCCCGGCACCGGCCCGCTGGGCGAA
GCGGGATTGGGCGGACATATCGACAACCACTTCTGGGAACGCTTTGGCAACGCCATCCTTCTTTCTCTGG
TGGGCGACTTCGGTAACTGGGCATCCAATCAAGGGCAATCGGGCAGCAACAACATCCGCTTTGACAACAC
CGCCGAGGGTGGTCAGGAAGCGGTTGCAAAGATTCTGGAAAAGTCCCTGGACATTCCTCCCACCCTTTAC
AAGAACCAGGGCGAGCGTATCGGCATCATGGTCGCCCGTGATCTGGATTTCAGTCACGTCTATGAGCTTG
AACCCATCCACTGA
 Primer design