SecReT4
Protein ID: 163858578
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4260
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4520359..4521765 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDA9IAN4
KEGG IDbpt:Bpet4260
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 468 a.a.     [Download]
>gi|163858578|ref|YP_001632876.1| unnamed protein product [Bordetella petrii DSM 12804]
MKRPELTNLSTKACRLLRPTVLAGLLAGALVLGGGLAWAQAGFQTGGSVIGDEVMYSIGGGSAVSMGRVA
GMRSIGVGVGWNSNLICGDMSIQTTLRNQLNGVTNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNL
LTNGVLQARLDFDRSKLTCRAMAEKMADTAGGQLGWSQMAEGMALRDAVSSTDAVSAIEQAETRRGNDGV
PWVGGSNAGGAGQSAIRVVGDVTRAGYNLVNGRSVTDTSSIAAASCASLSCQTWTSPQQATEWATRVLGE
QVQRTCDACTKTETVPGVGLTPLIQEEYEAKLEALQELVSGTRNTTFENLRAAGSTSLPITRGVIEALRD
EPDQDLLARRLASEVALASVLEKALLLQRTLLTGKKEPNVAANQLAVEAVNHESDTLDQEIRNLKTELEL
RRELANNSPMAIIQRHGTRAAGSRGIYEGDPIPDRLDRLQKGNPGGNP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4521765-4520359 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGCGTCCTGAACTGACAAACCTCTCCACCAAGGCGTGCCGCCTGCTGCGTCCCACGGTATTGGCTG
GGCTGCTGGCTGGCGCACTCGTTCTTGGCGGCGGCCTGGCGTGGGCGCAGGCCGGATTTCAGACCGGCGG
CTCCGTGATCGGCGACGAAGTGATGTATTCGATTGGCGGCGGCAGCGCGGTGTCCATGGGCCGCGTGGCC
GGCATGCGCTCGATCGGCGTTGGCGTGGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGA
CCACGCTGCGCAACCAGCTCAACGGCGTCACCAACGGCTTTCAGCAGATCATGAGCAACGTGATCCAGAG
CGCCACCAGCGCGGTGGCATCGCTGCCTGCGCTGATCATCCAGCGCGCCGATCCCGGCCTGTACAACCTG
CTGACCAACGGCGTGCTGCAGGCGCGCCTGGATTTCGACCGATCCAAGCTGACCTGCCGTGCCATGGCCG
AGAAGATGGCCGACACGGCGGGCGGACAACTCGGCTGGAGCCAGATGGCCGAAGGCATGGCACTGCGCGA
TGCGGTGTCGAGCACGGATGCCGTGTCGGCAATTGAACAGGCGGAGACGCGCCGCGGCAACGACGGCGTG
CCTTGGGTGGGTGGTAGCAATGCGGGCGGCGCAGGCCAGTCGGCCATCCGCGTGGTCGGCGACGTCACCC
GCGCAGGCTACAACCTGGTCAACGGCCGCAGCGTGACCGACACATCGTCCATCGCTGCCGCCAGTTGCGC
GAGTCTGTCTTGCCAGACCTGGACCTCGCCACAGCAGGCGACCGAATGGGCCACACGGGTTCTCGGCGAA
CAGGTGCAGCGCACTTGCGATGCCTGCACCAAGACCGAAACGGTGCCCGGCGTCGGGCTGACGCCGCTGA
TCCAGGAGGAGTACGAGGCAAAGCTGGAAGCCTTGCAGGAACTGGTCTCGGGAACGCGCAACACCACCTT
CGAGAACCTGCGTGCGGCTGGCAGCACCTCGCTGCCCATCACACGCGGCGTCATCGAGGCGCTGCGCGAC
GAGCCGGATCAAGACCTGCTGGCGCGGCGCCTGGCCTCGGAGGTCGCGCTGGCGTCGGTGCTGGAGAAGG
CATTGCTGCTCCAGCGCACCCTGCTGACCGGCAAGAAGGAGCCCAACGTCGCGGCGAACCAGTTGGCGGT
CGAGGCCGTGAACCACGAGAGCGACACGCTCGACCAGGAAATCCGCAACCTCAAGACCGAGCTGGAGCTG
CGCCGCGAGCTGGCGAACAACTCCCCCATGGCCATCATCCAGCGCCACGGCACGCGCGCGGCTGGCTCGC
GTGGCATCTACGAAGGCGATCCCATTCCCGACCGCCTTGACCGGCTCCAGAAGGGCAATCCGGGAGGCAA
CCCATGA
 Primer design