SecReT4
Protein ID: 163858584
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4266
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4527693..4528142 [-]
Productlipoprotein
Component typeTfc15
UniProt IDA9IAQ0
KEGG IDbpt:Bpet4266
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|163858584|ref|YP_001632882.1| unnamed protein product [Bordetella petrii DSM 12804]
MPSNLNSWAQGLALALAVALLGGCATSKEKLLTHGDSTMMNIWQQNAGDGGGGAGQVARRQLLDARQSLR
RPLAEMDVQAAPAEQMRYTRTARNEVYRQFQRLPNPDLVMYVYPHLAGTDPVPIPGYTTVFQLYQRVQYA
MPGERVEDY
 
Nucleotide Sequence: 450 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4528142-4527693 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCCCTCGAACTTGAATAGCTGGGCTCAGGGCCTGGCGCTGGCCTTGGCCGTCGCGCTGCTCGGTGGCT
GCGCCACCAGCAAGGAAAAGCTGCTGACCCACGGAGACAGCACGATGATGAACATCTGGCAGCAGAACGC
CGGCGACGGCGGCGGTGGTGCCGGCCAGGTAGCGCGCAGGCAGTTGCTCGATGCGCGCCAGAGCCTGCGC
AGGCCGCTGGCCGAGATGGACGTGCAGGCCGCGCCTGCCGAGCAGATGCGCTACACGCGCACGGCGCGCA
ACGAGGTCTACCGCCAGTTCCAGCGCCTGCCCAACCCCGATCTCGTGATGTACGTGTATCCGCATTTGGC
GGGCACCGACCCAGTGCCGATTCCGGGCTATACGACCGTGTTCCAGCTGTACCAGCGCGTGCAGTACGCC
ATGCCAGGCGAGCGCGTGGAGGATTACTGA
 Primer design