SecReT4
Protein ID: 163858585
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4267
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4528123..4529532 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDA9IAQ3
KEGG IDbpt:Bpet4267
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 469 a.a.     [Download]
>gi|163858585|ref|YP_001632883.1| unnamed protein product [Bordetella petrii DSM 12804]
MRSNGLLKWLLIPVALLVLSVAIRLFSGGGASAPPVADGGGRLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALSDNRSQREENQRLRQRENAIDQRISSALESERSNLRRDQQQAASARQQTEGLLADLQQRL
DSIGGRGGGHADLPVGLGLRDGDEAGMEGGMRWVEPDDAKQSDGRGRSNGGISFPTSFGSAQSTLETTAQ
TVANAGARAAGVKSPTPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPD
VAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCVSGE
RRSNAQQYLGTQALITAAGAGVASLIESDSGRASYVGADGSIGSVGISGQEAVGRILASGVQDMSSWVNK
LYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELE
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4529532-4528123 Bordetella petrii DSM 12804 chromosome, complete genome
ATGCGCAGTAACGGACTCCTGAAGTGGCTGCTGATCCCCGTGGCCCTGCTGGTGCTGTCTGTCGCCATCC
GGCTGTTTTCCGGTGGCGGTGCGTCGGCACCGCCTGTCGCGGATGGCGGCGGCAGGCTTACGCCGGAAGA
AATGAAGGCGCTGGGCATCGAGGGTGACACCCCGCGCGACACCGTGGCGACGCTGGTTGCCCAGGTGAAG
CAGTTGCGCACCGAGCTTCAGACCGCGCTGTCCGACAACAGGTCGCAGCGTGAGGAGAACCAGCGACTGC
GCCAGCGCGAGAACGCCATCGACCAACGCATCAGTTCCGCCCTCGAATCCGAGCGCTCCAACCTGCGCCG
CGACCAACAGCAGGCGGCCAGCGCGCGCCAGCAGACCGAGGGGCTGCTCGCTGACCTGCAGCAGCGCCTG
GACAGCATCGGCGGGCGTGGCGGCGGCCATGCCGATTTGCCGGTGGGGCTGGGCCTGCGTGACGGCGACG
AGGCCGGCATGGAAGGCGGTATGCGCTGGGTGGAGCCGGATGACGCGAAACAAAGCGACGGGCGTGGCAG
GTCGAATGGCGGCATAAGCTTCCCCACCAGCTTCGGTTCCGCACAGAGCACGCTGGAAACCACAGCGCAA
ACCGTGGCGAACGCGGGCGCACGCGCGGCAGGCGTCAAGAGCCCGACGCCCGTCTATACCGTGCCGACCA
ACTCGACGCTGATGGGGTCGGTGGCGATGACGGCGCTGATTGGCCGCGTGCCGATCGACGGCACGGTGAA
CGATCCATACCCCTTCAAGGTCTTGGTCGGGCCTGACAATTTGACCGCGAACGGCATCGACATTCCCGAT
GTGGCCGGGGCCGTGTTCTCCGGCACCGCATCGGGCGACTGGACGCTCTCCTGCGTGCGCGGCCAGGTGC
GCAGCATCACCTTCGTGTTCCATGACGGGACCATCCGCACCATCCCCGAGGATCGTGAGGGCAACCAGCA
GAACAACCAACAACGCGACGGCCTGGGCTGGATCAGCGACCCGCACGGCATTCCCTGTGTCAGCGGCGAG
CGGCGCAGCAATGCGCAGCAGTACCTCGGCACCCAGGCGCTGATCACGGCGGCTGGGGCTGGCGTGGCCT
CGCTGATCGAATCCGACAGTGGCAGGGCGTCCTATGTCGGCGCCGACGGCTCCATCGGCAGCGTGGGCAT
CAGCGGCCAGGAAGCCGTGGGCCGGATTCTCGCCAGCGGCGTCCAGGACATGTCGAGCTGGGTCAACAAG
CTCTACGGCCAGGCCTTCGCTGCCGTTTATGTGCAGCCCGGTGCCAAGGTCGCCGTCCACCTCGAAAAGC
CGCTCGCCATCGACTTCGATCCCGAAGGCCGCAAGGTCGATCACCGCGCAGGAGAAAGCCATGCCCTCGA
ACTTGAATAG
 Primer design