SecReT4
Protein ID: 163858588
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4270
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4531146..4531556 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA9IAR3
KEGG IDbpt:Bpet4270
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-48, Aligned region: 10..130
Protein Sequence: 136 a.a.     [Download]
>gi|163858588|ref|YP_001632886.1| unnamed protein product [Bordetella petrii DSM 12804]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLVVGAPLSWVLRTIAIAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATRHPLMAAWVGGHVLISRSGFWTIRRGMHGGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4531556-4531146 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCCGAGCAACAGCATGTCCGTGCCGATGGGACAGTCACGTTCCTTCCACACCGGCTCAACAGGCACC
CGGTGGTCGTGCGCGGCCTCACTGCCGATGAGTTGTGGATTTGCTGCGGCCTGTCCGGCGCTGCCGGCCT
GGTGGTTGGCGCGCCGCTGTCCTGGGTGTTACGCACCATTGCCATCGCGCCGACCTTCGTTGTCCTGGGC
GTGGCGCTGGGCGTTTTCATCGGCGGCGGCATCCTGCGCCGTCTCAAGCGTGGGCGTCCCGACACCTGGC
TGTACCGGCAGTTGCAGTGGCGCATTGCCACGCGCCATCCGCTGATGGCCGCTTGGGTGGGCGGCCATGT
GCTGATCTCGCGCTCCGGCTTCTGGACCATCCGCAGGGGCATGCACGGGGGCGCGCGATGA
 Primer design