SecReT4
Protein ID: 163858591
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4273
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4532176..4532559 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA9IAS2
KEGG IDbpt:Bpet4273
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.9e-29, Aligned region: 30..109
Protein Sequence: 127 a.a.     [Download]
>gi|163858591|ref|YP_001632889.1| unnamed protein product [Bordetella petrii DSM 12804]
MLAPIWLRAAHRGVPTFLVTALLMGQFPVALAESPAQRQELVAALRQLDALERTIADGAAHAPIQPGERY
HFDYPRLLADLARVRAGIQAHLTPSRAQPRDLSELAGEYRTERTAPPSLPTTAQGRP
 
Nucleotide Sequence: 384 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4532559-4532176 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTTGGCTCCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCAACTTTTCTCGTGACGGCCCTGCTGA
TGGGTCAGTTCCCGGTTGCCTTGGCCGAATCCCCGGCACAGCGCCAGGAGCTGGTTGCCGCGCTACGCCA
GCTCGACGCGCTGGAGCGCACCATCGCGGATGGCGCTGCACACGCACCCATCCAGCCGGGCGAGCGCTAC
CACTTCGATTACCCACGACTGCTGGCTGATCTGGCGCGTGTGCGCGCCGGCATCCAGGCCCATCTCACAC
CGTCGCGCGCCCAGCCACGCGACCTCTCCGAACTGGCTGGTGAGTACCGCACCGAGCGGACCGCCCCGCC
ATCGCTGCCGACGACTGCGCAGGGCAGACCATGA
 Primer design