SecReT4
Protein ID: 163858592
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4274
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4532658..4533419 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA9IAS3
KEGG IDbpt:Bpet4274
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.9e-69, Aligned region: 46..250
Protein Sequence: 253 a.a.     [Download]
>gi|163858592|ref|YP_001632890.1| unnamed protein product [Bordetella petrii DSM 12804]
MSDAASTAQREQNRRQGLIVGTITLPLRLLGVLVGSLLFSILMECIGMHLFWKDQGWQHSQQMLQYELGH
LSKHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAPSQGKNQDGGRNFRYFISQVYV
WTESYLIAAAFTTLTFLVRLLVLALTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPL
AVLPWVTYLALPISVHPLLILLPSAGLLGLAVSLTAGSFKKYL
 
Nucleotide Sequence: 762 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4533419-4532658 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAGCGATGCCGCCTCGACTGCGCAGCGCGAGCAGAACCGCCGCCAGGGCTTGATCGTCGGCACCATCA
CCTTGCCGCTCCGGCTGCTCGGGGTGCTGGTCGGCTCGCTGCTGTTCTCGATCCTGATGGAGTGCATCGG
CATGCACCTGTTCTGGAAAGACCAGGGCTGGCAGCACTCCCAGCAAATGTTGCAGTACGAGCTGGGGCAC
CTGTCCAAGCATTTCACGCGCAGCGTGGTCGTGCAGGAGCCGGGGCGAACGGCGCACGAGCTGGTGGACA
CGGGTTATGAATGGGTGTTCGTGCGATCAGGGCTCCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
CGCGCCCAGCCAGGGGAAAAACCAGGACGGAGGGCGCAACTTCCGCTACTTCATCAGCCAGGTCTATGTC
TGGACGGAGAGCTACCTGATCGCCGCAGCCTTCACGACGCTTACTTTCCTCGTGCGCCTGCTGGTCCTGG
CGCTCACGCTGCCGCTGATCTTCACGGCCGCTTTCGTCGGCCTGATCGACGGTTTGGTACGGCGGGATGT
GCGCCGGTTCGGCGCAGGCCGGGAATCCGGCTTTATCTATCACCGAGCGAAAGCGAGCCTGATGCCGCTG
GCCGTGCTGCCCTGGGTCACGTACCTGGCGCTGCCGATCTCGGTGCATCCGCTGCTGATCCTGCTGCCCA
GCGCCGGCTTGCTGGGGCTGGCCGTGAGCCTGACTGCAGGGAGCTTCAAGAAGTACCTCTAG
 Primer design