SecReT4
Protein ID: 163858594
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4276
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4534929..4535600 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDA9IAT0
KEGG IDbpt:Bpet4276
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|163858594|ref|YP_001632892.1| unnamed protein product [Bordetella petrii DSM 12804]
MSGKQPVEVLLRPAVEFYTVAACAGAAFLSLVAPWSLALSPAMGVGSALAFGAYGAIRYRDARVILRYRC
NIRRLPRYVMTSRDVPVSQQRLFIGRGFLWEQKHTHRLMQTYRPEFRRYVEPTPAYRLARRLEARLEFAP
FPLSRLPRLTGWDVPFNPVRPLPPVGGPAAASRYRAGGSGRQPAARGARRAFTGAGHDARGQDAARRAVR
DAGHPPQERRWRT
 
Nucleotide Sequence: 672 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4535600-4534929 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCGGGGAAACAGCCGGTCGAGGTTCTGCTGCGCCCAGCGGTGGAGTTCTATACCGTCGCGGCGTGTG
CAGGCGCCGCGTTTCTGTCCCTGGTGGCCCCGTGGTCGCTCGCGCTGAGTCCGGCGATGGGTGTCGGCAG
CGCGCTGGCGTTTGGCGCCTACGGTGCCATCCGCTACCGCGATGCCCGAGTTATCCTGCGGTACCGGTGC
AACATCCGCCGCCTGCCGCGCTACGTGATGACCAGCCGCGACGTGCCGGTCAGCCAGCAGCGGCTCTTCA
TTGGTCGGGGTTTTCTCTGGGAGCAGAAGCACACCCATAGGCTGATGCAGACGTACCGACCGGAGTTCCG
CCGCTACGTGGAGCCGACGCCGGCCTACCGGCTGGCGCGTCGCCTGGAGGCACGGCTGGAGTTCGCGCCG
TTTCCGCTTTCACGTCTGCCTAGGCTCACAGGCTGGGATGTGCCTTTCAACCCTGTGCGGCCGCTGCCGC
CCGTGGGGGGGCCTGCCGCGGCTTCACGGTATCGAGCCGGAGGAAGTGGACGTCAGCCTGCCGCTAGGGG
AGCGCGTCGGGCATTCACTGGTGCTGGGCACGACGCGCGTGGGCAAGACGCGGCTCGCCGAGCTGTTCGT
GACGCAGGACATCCGCCGCAAGAACGCCGCTGGCGAACATGA
 Primer design