SecReT4
Protein ID: 163858596
T4SS name [ID]Tfc [736]
Gene symbol-
Locus tagBpet4278
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4536150..4536755 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDA9IAT6
KEGG IDbpt:Bpet4278
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 201 a.a.     [Download]
>gi|163858596|ref|YP_001632894.1| unnamed protein product [Bordetella petrii DSM 12804]
MAAPAIAATSVSQCLRALVIAAGLCACAAHAQELPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRIV
PWPWSLNVAGQSRRFTTRADACAGLQQAMRATPHTRIDAGLGQINLGYHQQRYASPCDLLDPYSNLAIAA
EILKEQHTSGEDWLPAIGRYHRPAGGEPAARYRRSVSRHLARVQGTHPTAAAIAVHQESTP
 
Nucleotide Sequence: 606 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4536755-4536150 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAGCGCCAGCCATAGCGGCCACCTCCGTTTCGCAGTGCTTGCGCGCACTGGTGATCGCGGCGGGCC
TGTGCGCCTGCGCCGCCCATGCCCAGGAGCTTCCGCCACCGGCTTACCAGCTTGCCGCACAGCGCGCGGG
CATCCCCTCGACGGTGCTCTACGCCGTGGCTTTGCAGGAAAGCGGCATCCGCCGCAACGGGCGCATCGTC
CCGTGGCCGTGGTCCCTCAACGTCGCCGGTCAGTCGCGCCGCTTCACCACCCGTGCCGACGCCTGCGCTG
GTTTGCAGCAGGCAATGCGCGCCACGCCGCACACACGCATCGACGCGGGCCTGGGCCAGATCAACCTCGG
CTACCACCAGCAGCGCTACGCCAGCCCGTGCGACCTGCTCGACCCATACAGCAACCTCGCCATCGCCGCT
GAAATCCTGAAAGAGCAGCACACCTCGGGCGAGGACTGGTTGCCGGCGATCGGTCGCTACCACCGTCCTG
CGGGCGGAGAACCTGCGGCTCGTTACCGGCGCAGCGTGTCGCGCCACCTTGCCCGTGTGCAGGGCACACA
CCCAACCGCCGCGGCCATCGCCGTGCACCAGGAGAGCACCCCATGA
 Primer design