SecReT4
Protein ID: 163858938
T4SS name [ID]Trb [350]
Gene symboltrbC2
Locus tagBpet4618
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4880212..4880565 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA9IF57
KEGG IDbpt:Bpet4618
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.9e-22, Aligned region: 18..107
Protein Sequence: 117 a.a.     [Download]
>gi|163858938|ref|YP_001633236.1| trbC2 gene product [Bordetella petrii DSM 12804]
MKSVSSPTYVPAFRDQALAFAHRFGGLLLLFAVGALHAAGSSMPWEAPLQSILESVQGPVARIVAVIIII
VTGLTLAFGDTNGGFRRLIQIVFGLSIAFAASSFFLSFFSFSGGALI
 
Nucleotide Sequence: 354 bp     [Download]
>gi|163854304|ref|NC_010170.1|:4880212-4880565 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAAGTCGGTCTCGTCACCAACTTATGTACCCGCATTCCGCGACCAGGCTTTGGCTTTTGCGCATCGCT
TTGGCGGGCTGTTGTTGCTCTTTGCCGTGGGCGCGCTGCACGCGGCCGGTTCCAGCATGCCGTGGGAAGC
CCCGCTGCAATCCATTCTGGAATCGGTGCAGGGGCCGGTGGCGCGCATCGTCGCGGTCATCATCATTATC
GTGACCGGGCTCACGCTGGCGTTTGGCGATACGAACGGCGGATTTCGTCGGCTGATTCAGATCGTGTTCG
GCCTGTCCATTGCCTTTGCGGCCTCGTCGTTCTTTCTGTCGTTCTTCTCCTTCTCGGGCGGCGCGCTGAT
ATGA
 Primer design