SecReT4
Protein ID: 163858943
T4SS name [ID]Trb [350]
Gene symboltrbL2
Locus tagBpet4623
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4884272..4885534 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9IF63
KEGG IDbpt:Bpet4623
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.8e-48, Aligned region: 37..262
Protein Sequence: 420 a.a.     [Download]
>gi|163858943|ref|YP_001633241.1| trbL2 gene product [Bordetella petrii DSM 12804]
MNDLAIIDRFTNIFSRYIDSGFGLVNGEVAFLSATLVVIDMTLAGLWWAMDHGQNDVLARLIKKVLYVGV
FAFILGNFNWLSGIVFRSLSGLGLMASGSSLTIAEFLQPGRLAQVGVDTAAPLLERVGDLSGFTSVFANL
DTIVVLLLAWLVVILSFFVLAIQLFVTLIEFKLTTLAGFVLVPFALWGKTAFLAEKVLGNVISAGIKVLV
LAVIVGISTLVFNDFRTAMGPEPTLDDAAAVMLASLAMLGLGIFGPSIATGLVSGAPQLGAGAVAGTALG
TAGVATAGAVAGATVAGGAARMAGGGVRAATSMASGARKAYVEGASFSGKTGWRATAAGLKDVARAGASA
AGRGVKSRVMGAGRASPAGGSTVAPSAPPAWAKRAQARQRATQGATMAAHAVRSGDAGGNGLIPSLRDDS
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|163854304|ref|NC_010170.1|:4884272-4885534 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAACGATCTGGCCATTATCGACCGCTTCACCAACATTTTCTCCCGCTACATTGATTCGGGCTTTGGCC
TGGTCAATGGCGAGGTGGCGTTCCTGTCGGCCACGCTGGTGGTCATCGACATGACGCTGGCGGGCTTGTG
GTGGGCGATGGATCATGGTCAGAACGACGTGCTGGCACGACTCATCAAAAAAGTGCTGTACGTCGGCGTG
TTCGCCTTCATTCTGGGTAACTTCAACTGGTTGTCGGGCATTGTGTTCCGTTCGCTGTCCGGTTTAGGAC
TCATGGCCTCCGGTTCATCACTGACGATCGCCGAGTTCTTGCAACCGGGCCGGCTTGCGCAGGTGGGCGT
CGATACCGCCGCGCCGCTCCTGGAGCGCGTGGGTGACCTGTCGGGCTTTACCTCGGTCTTTGCCAATTTA
GACACCATCGTGGTGCTGTTGCTGGCCTGGCTTGTCGTGATCCTGAGTTTTTTTGTGCTGGCGATTCAGC
TTTTCGTGACGTTGATCGAATTCAAGTTGACCACTTTGGCCGGCTTCGTACTGGTGCCGTTTGCGTTGTG
GGGCAAGACCGCCTTTTTGGCCGAGAAGGTGTTGGGCAATGTCATTTCCGCGGGCATCAAGGTATTGGTG
CTCGCGGTCATTGTCGGCATCAGTACGCTCGTCTTTAACGATTTTCGTACCGCGATGGGCCCTGAGCCGA
CATTGGATGATGCCGCTGCCGTGATGCTGGCCTCGCTGGCCATGCTGGGTCTGGGGATTTTCGGGCCAAG
CATCGCGACGGGTCTGGTTTCCGGTGCGCCGCAACTGGGCGCGGGTGCGGTGGCCGGCACCGCGCTGGGC
ACAGCCGGTGTGGCGACAGCCGGTGCCGTTGCGGGTGCCACGGTGGCGGGCGGTGCGGCTCGGATGGCTG
GCGGCGGTGTACGGGCGGCCACGTCGATGGCCAGCGGCGCGCGCAAGGCCTATGTGGAAGGGGCGAGCTT
TTCGGGCAAGACCGGCTGGCGAGCCACTGCGGCGGGACTGAAAGATGTCGCCCGCGCCGGCGCCTCGGCG
GCGGGCCGTGGCGTGAAGTCCCGTGTCATGGGGGCCGGACGCGCCAGTCCTGCGGGTGGATCCACCGTCG
CACCATCCGCACCGCCCGCCTGGGCCAAACGCGCGCAGGCCCGCCAGCGCGCTACCCAAGGCGCGACGAT
GGCCGCGCACGCCGTGCGCTCGGGCGATGCCGGCGGCAATGGCCTGATTCCCAGCCTACGTGACGATTCC
TGA
 Primer design