SecReT4
Protein ID: 163858945
T4SS name [ID]Trb [350]
Gene symboltrbG2
Locus tagBpet4625
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T4SS(s) in this replicon]
Location [Strand]4886469..4887434 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA9IF66
KEGG IDbpt:Bpet4625
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5e-63, Aligned region: 92..311
Protein Sequence: 321 a.a.     [Download]
>gi|163858945|ref|YP_001633243.1| trbG2 gene product [Bordetella petrii DSM 12804]
MLVAALAGCATRGTPPPEIALDDPVVAVSSPVQVPEPPTPVEIVPMPQPLPLPGQLKALKDKPAPEQTSP
TAQVNRANSEARMAPTRDGFINAIQVWPYSEGALYQVYASPGRVTLVQLQVGERLIDVSAGDTVRWIVGD
SSSGTGATARPNLQIKPIRAGLKTNLVVTTDRRIYLLELASTQSAWMASVSWDYPQDRLAALKRRNEAAA
QAMPLGAGVSVDQLRFRYAITGDTPPWRPLRAFDDGQKVYIQLPPGIIQGELPPLFLVGSDGDLQLLNYQ
YRAPYYVVDRLFGAVELRLGADDAQIVRIERNDGKTVRGGT
 
Nucleotide Sequence: 966 bp     [Download]
>gi|163854304|ref|NC_010170.1|:4886469-4887434 Bordetella petrii DSM 12804 chromosome, complete genome
GTGCTCGTCGCGGCGCTGGCCGGTTGCGCCACACGCGGCACGCCGCCGCCCGAGATCGCGCTGGACGATC
CTGTCGTGGCGGTCAGTTCGCCGGTCCAAGTGCCTGAACCTCCTACGCCAGTGGAAATCGTGCCGATGCC
ACAGCCTTTGCCGCTGCCGGGGCAGTTGAAGGCACTCAAAGACAAACCCGCACCCGAGCAGACCAGCCCG
ACGGCACAGGTCAATCGCGCCAACAGCGAGGCACGCATGGCGCCTACGCGCGATGGGTTCATTAACGCGA
TACAGGTCTGGCCCTACAGCGAAGGCGCGCTGTACCAGGTCTACGCCAGTCCCGGGCGCGTAACGCTGGT
GCAACTGCAAGTAGGTGAACGGCTGATCGACGTGTCCGCAGGCGATACGGTGCGCTGGATTGTCGGAGAC
TCATCAAGCGGCACGGGCGCTACGGCTCGGCCCAATCTGCAGATCAAGCCGATACGCGCCGGTTTGAAAA
CGAATCTGGTGGTCACGACCGATCGACGCATTTACTTGTTGGAACTGGCTTCCACCCAGTCGGCCTGGAT
GGCTTCGGTGTCGTGGGACTATCCGCAGGACAGGCTGGCCGCATTAAAGCGGCGCAACGAAGCGGCAGCG
CAAGCCATGCCGCTGGGCGCAGGCGTATCGGTAGACCAGTTGCGATTCCGTTATGCCATCACGGGCGACA
CACCGCCGTGGCGGCCGCTACGCGCCTTTGATGACGGCCAGAAGGTCTACATCCAGTTACCGCCCGGCAT
CATACAAGGGGAACTGCCGCCTTTGTTCCTCGTTGGATCGGACGGCGATCTGCAATTGTTGAACTACCAG
TACCGTGCGCCGTACTACGTGGTGGATCGGCTCTTTGGTGCGGTGGAGTTGCGCTTGGGCGCAGACGACG
CCCAGATCGTGCGCATCGAGCGCAACGACGGCAAAACGGTGCGAGGTGGCACATGA
 Primer design