SecReT4
Protein ID: 163868779
T4SS name [ID]VirB [225]
Gene symbolvirB7
Locus tagBtr_1694
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]1804879..1805193 [+]
ProductVirB7 protein
Component typeVirB7
UniProt IDA9IWN4
KEGG IDbtr:Btr_1694
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 104 a.a.     [Download]
>gi|163868779|ref|YP_001610003.1| VirB7 protein [Bartonella tribocorum CIP 105476]
MKRKITFVMILTIALTGCASLSGPKKPPRCNGKHTRALNKDKWDWNNKNIVLQEKAVKPVTSPIILNTLD
SEKETANLTLHPALLKPVIHEAQFDKTVEVTREK
 
Nucleotide Sequence: 315 bp     [Download]
>gi|163867306|ref|NC_010161.1|:1804879-1805193 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAACGAAAAATAACTTTTGTTATGATCCTAACAATCGCCCTTACCGGCTGTGCTTCTTTGAGTGGAC
CTAAAAAACCACCACGCTGTAATGGCAAACATACGCGTGCTTTAAATAAAGATAAGTGGGATTGGAACAA
TAAAAATATTGTCCTGCAAGAAAAGGCTGTAAAACCTGTTACCTCACCCATCATTCTCAATACTTTAGAT
AGTGAAAAAGAAACAGCCAACCTAACACTTCATCCAGCTTTATTAAAGCCGGTTATTCATGAAGCACAAT
TTGATAAAACTGTGGAGGTTACGCGTGAAAAGTGA
 Primer design