SecReT4
Protein ID: 163868780
T4SS name [ID]VirB [225]
Gene symbolvirB8
Locus tagBtr_1695
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]1805183..1805851 [+]
ProductVirB8 protein
Component typeVirB8
UniProt IDA9IWN6
KEGG IDbtr:Btr_1695
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-61, Aligned region: 12..219
Protein Sequence: 222 a.a.     [Download]
>gi|163868780|ref|YP_001610004.1| VirB8 protein [Bartonella tribocorum CIP 105476]
MKSDALEEYIKEARSFDIDRMHGMRVRMKISMALTVLFGLMTIALALAVAALTPLKTVEPFVIRVDNSTG
IIDTVSALKESPSDYDEAITRYFASQYVRAREGFQASEAENSFRLVSLLSSPKEQNRFAKWYAGNNPESP
QNIYHNMIATVTIKSISFISKDLIQVRYYKTVRDFSEKETISHWVSILNFSYVNAHISTSDRLINPLGFQ
VSEYRSDPEVIK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|163867306|ref|NC_010161.1|:1805183-1805851 Bartonella tribocorum CIP 105476 chromosome, complete genome
GTGAAAAGTGATGCCCTTGAAGAATATATAAAAGAAGCACGCTCATTTGACATTGATCGCATGCATGGCA
TGCGCGTGCGGATGAAAATTTCCATGGCTTTAACAGTGCTTTTTGGATTGATGACAATTGCGCTCGCTTT
GGCTGTCGCAGCTTTGACGCCCTTGAAAACTGTAGAACCTTTTGTTATCCGCGTTGATAACTCAACAGGC
ATCATCGATACTGTAAGTGCCCTAAAAGAATCCCCTAGCGACTATGATGAAGCGATAACGCGTTATTTTG
CTAGCCAATATGTTCGTGCTCGTGAAGGTTTTCAAGCATCAGAGGCAGAAAACAGTTTTCGCTTAGTCTC
TCTTTTATCTTCTCCAAAAGAACAAAATCGTTTTGCAAAATGGTACGCGGGCAATAATCCAGAAAGTCCA
CAAAATATTTATCATAACATGATTGCTACAGTCACAATCAAATCAATCTCTTTTATAAGCAAAGATCTTA
TCCAAGTTCGTTACTATAAAACGGTCAGAGACTTTAGTGAAAAAGAAACTATTTCCCATTGGGTTTCAAT
CTTAAATTTTTCTTATGTTAACGCACACATTTCAACCTCTGACCGTCTCATCAACCCCCTTGGTTTTCAA
GTATCGGAATATAGATCTGATCCAGAGGTGATAAAATGA
 Primer design