SecReT4
Protein ID: 163868783
T4SS name [ID]VirB [225]
Gene symbolvirB11
Locus tagBtr_1698
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]1807876..1808946 [+]
ProductVirB11 protein
Component typeVirB11
UniProt IDA9IWP1
KEGG IDbtr:Btr_1698
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.7e-94, Aligned region: 20..333
Zeta_toxin [PF06414], Evalue: 8.2e-05, Aligned region: 178..214
Protein Sequence: 356 a.a.     [Download]
>gi|163868783|ref|YP_001610007.1| VirB11 protein [Bartonella tribocorum CIP 105476]
MNPNLRTMNDEAVAIVLTKLEPISTFLRDEGLFEIVINRPYQVMTEGIDGWKTIEAPALSFNELMGIAKV
VASYSKQNISDRNPILSATLPGNERIQIVIPPAVEKDTISMTIRKPSSQSFSLEELANKGLFSLCEQVSF
TPLNDYHARFNELKIIEHNLANAYCNKDFVSFLNQAVKCQKNILIAGKTGSGKTTLSKALIAKIPQDERI
ITIEDTQELVIPHPNHVSMIYSKDGQGLASVGPKELLESSLRMRPDRILLQELRDGTAFYYIRNVNSGHP
GSITTVHASTALAAFEQMTLLVKESEGGGDLERDDIRGLLISMIDIIIQCKRVEGKFKVTEIYYDPFKQR
NIFGGD
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|163867306|ref|NC_010161.1|:1807876-1808946 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAATCCAAATTTACGCACCATGAATGATGAAGCAGTCGCGATTGTTCTCACAAAACTTGAACCTATCA
GTACTTTTTTGAGAGATGAGGGTCTTTTTGAAATTGTTATCAATCGTCCCTATCAAGTGATGACGGAAGG
AATTGATGGGTGGAAAACGATAGAAGCACCTGCTCTCTCTTTTAATGAACTGATGGGAATTGCGAAAGTT
GTCGCGTCCTATTCTAAGCAAAATATATCAGATAGGAATCCAATATTATCAGCGACTCTCCCAGGCAATG
AGCGCATTCAAATTGTCATTCCACCCGCTGTCGAAAAAGACACAATTAGTATGACAATTCGTAAACCATC
GTCGCAGAGTTTTTCTCTCGAAGAGCTTGCCAATAAAGGTCTCTTCTCATTATGTGAGCAGGTCTCTTTC
ACACCATTGAATGATTATCATGCGCGTTTTAACGAACTCAAAATCATCGAGCATAATCTAGCCAATGCCT
ACTGCAATAAAGACTTTGTTTCCTTTTTAAATCAGGCTGTAAAATGCCAAAAAAATATTCTGATTGCAGG
AAAAACTGGTTCGGGTAAAACAACATTATCAAAGGCATTAATTGCAAAAATTCCTCAAGACGAGCGTATT
ATCACCATTGAAGACACACAGGAATTGGTGATACCGCACCCTAACCATGTCTCGATGATCTATTCAAAAG
ATGGACAAGGCTTAGCTTCTGTTGGTCCCAAAGAATTACTTGAATCATCTTTACGGATGCGTCCTGATCG
TATTCTTTTGCAAGAGCTTCGAGATGGTACAGCCTTTTATTATATCCGCAATGTCAATTCAGGCCACCCA
GGTTCCATTACGACCGTTCATGCATCAACAGCCCTTGCAGCCTTTGAACAAATGACCCTTTTGGTCAAAG
AAAGTGAAGGAGGGGGGGATTTAGAGCGTGATGATATTCGAGGTTTATTGATTTCAATGATTGATATTAT
CATCCAATGCAAACGGGTTGAAGGAAAATTTAAGGTCACAGAAATTTATTATGATCCCTTCAAGCAACGT
AACATTTTTGGCGGTGACTAA
 Primer design