SecReT4
Protein ID: 163868786
T4SS name [ID]VirB [225]
Gene symbolvirD4
Locus tagBtr_1701
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]1811015..1812931 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDA9IWP5
KEGG IDbtr:Btr_1701
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.7e-103, Aligned region: 158..636
TraG-D_C [PF12696], Evalue: 6.8e-29, Aligned region: 475..593
TrwB_AAD_bind [PF10412], Evalue: 2.4e-21, Aligned region: 318..609
Protein Sequence: 638 a.a.     [Download]
>gi|163868786|ref|YP_001610010.1| conjugal transfer coupling protein TraG [Bartonella tribocorum CIP 105476]
MKYTKTQMVLILIPIALGTLTIFLVPHFLLLITNGLKSNQIYWTLRSEPLLILVLTAAISLLYSLSQKLH
LRKTITFVSVVFFGTIALYYVGSEIKRLSPYVGQQGITWSYALQFMDPMVVFGIIIGTFFSLIQFITTSP
PKNKVKRAKKEVFGGAAWMDLREAAKIFPADGQIVVGERYRVDQDNVCKIPFAPGNKTTWGKGGAVPLLT
FNLDFGSTHMIFFAGSGGYKTTSTVIPTCLTYPGSIICLDPSTEVAPIVKFARQKMGNRNVIILDPNSLL
TKSFNVIDWLLDDSVPRTQREANIVSFSKLLLTDKKSDNSSAEYFSTQAHNLLTALLAHVIFSDEYEDHE
RNLKTLRGILSQSETAIINQLRMIQETTPSPFIREMVGIFTEMAEQTFSGVYTTASKDTQWLSLSNYADL
VCGDDFSSSDIANGNIDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVLDEVDLLGYMN
ILEEARDRGRKYGTSLMLFYQSTGQLVNHFGESGARSWFESCSFVSYAAIKDLQTAKEISERCGQMTVEV
TGVSKSRGLSLGKSSYNINYQQRALILPHEVIQEMRQDEQIILMQGQPPLRCGRAIYFRRKEMLAASAKN
RFAPQKKN
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|163867306|ref|NC_010161.1|:1811015-1812931 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAATATACCAAGACACAAATGGTCCTTATTTTAATCCCTATTGCTTTAGGTACTTTAACGATATTCC
TTGTCCCTCATTTTTTGTTGTTGATAACAAATGGACTAAAGAGTAATCAAATTTATTGGACTCTTCGTTC
AGAGCCTTTATTAATCTTAGTACTAACAGCTGCTATTTCATTGTTATACAGTCTCTCTCAAAAACTACAC
CTACGTAAAACAATTACTTTTGTCTCCGTTGTCTTTTTTGGAACCATTGCTCTTTACTATGTTGGGAGTG
AAATAAAACGCTTAAGTCCCTATGTTGGTCAACAAGGAATAACGTGGAGTTATGCGCTTCAATTTATGGA
TCCTATGGTTGTCTTTGGCATCATCATTGGTACTTTTTTTTCTCTCATTCAATTCATTACAACCTCTCCA
CCTAAAAATAAGGTCAAGCGTGCCAAAAAAGAGGTTTTTGGGGGAGCGGCATGGATGGATTTAAGAGAAG
CAGCAAAAATCTTTCCTGCCGATGGGCAAATTGTTGTGGGGGAAAGATACCGTGTTGATCAAGATAATGT
ATGCAAAATTCCATTTGCACCTGGCAATAAAACAACATGGGGGAAAGGTGGAGCAGTACCTTTGCTAACC
TTTAATCTTGATTTTGGTTCAACCCATATGATCTTTTTTGCTGGTTCTGGTGGTTATAAAACCACAAGTA
CAGTAATTCCTACGTGTTTAACCTATCCAGGGTCTATTATTTGTCTTGATCCTTCAACAGAAGTTGCCCC
AATCGTCAAATTTGCTCGTCAAAAGATGGGCAATAGAAATGTTATTATTCTTGATCCTAATTCACTTTTA
ACAAAAAGTTTTAATGTCATCGATTGGCTTTTAGACGACAGTGTACCCCGCACACAACGTGAAGCAAATA
TTGTTAGCTTTTCCAAATTGCTTCTCACGGATAAAAAATCAGACAATTCTTCGGCGGAATATTTCTCGAC
ACAAGCCCATAATCTTTTAACGGCTCTTCTTGCTCATGTGATATTTTCTGATGAATATGAAGACCATGAG
CGCAACTTAAAAACATTGCGTGGAATTCTCTCTCAATCAGAAACAGCTATTATCAATCAATTACGCATGA
TTCAAGAAACAACCCCTTCTCCTTTTATTCGTGAAATGGTGGGTATTTTTACAGAAATGGCAGAACAAAC
TTTTTCAGGAGTCTATACAACTGCCTCAAAAGACACCCAATGGCTTTCTTTGTCTAATTACGCAGATCTT
GTCTGCGGTGATGATTTTTCCTCCTCAGATATTGCCAATGGTAATATAGATGTTTTTCTCAATCTCCCCG
CCAGCATTTTAAACAGCTATCCAGCGATAGGACGTGTAATTATTGGTGCCTTTCTCAATGCTATGGTTAC
AGCAGACGGTAACTATAAAAAGCGTGTTTTATTTGTCTTAGATGAAGTTGATCTTCTAGGCTATATGAAT
ATTTTAGAAGAAGCTCGTGATCGTGGACGTAAATACGGCACATCCTTAATGCTCTTTTATCAATCCACGG
GTCAGTTGGTCAATCACTTTGGTGAATCAGGGGCACGTTCATGGTTTGAAAGCTGCTCCTTTGTCAGTTA
TGCTGCCATTAAAGACCTCCAAACAGCGAAAGAGATTTCAGAACGCTGTGGTCAAATGACCGTTGAAGTC
ACCGGAGTAAGCAAATCAAGAGGTTTATCTTTAGGAAAGAGCTCTTACAATATCAATTACCAACAAAGAG
CTCTCATTTTACCCCACGAGGTTATTCAAGAAATGCGTCAAGATGAACAAATTATTCTTATGCAAGGGCA
ACCTCCCTTGCGATGTGGCCGTGCCATCTATTTCAGAAGAAAAGAAATGTTAGCTGCTTCTGCAAAAAAT
CGTTTTGCCCCACAAAAGAAAAACTAG
 Primer design