SecReT4
Protein ID: 163869109
T4SS name [ID]VirB [226]
Gene symbolvblB7
Locus tagBtr_2341
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2298689..2298976 [+]
ProductVblB7 protein
Component typeVirB7
UniProt IDA9IYF5
KEGG IDbtr:Btr_2341
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|163869109|ref|YP_001610347.1| VblB7 protein [Bartonella tribocorum CIP 105476]
MREFKKIGVILPFLFLSGCMSSPNTLKSLPKCDGYSKRPLNRSMWNWEGKKPTSTPIIISNNTPSPQKEG
KLETLLAQKPTDEEMKSYKNCGQKA
 
Nucleotide Sequence: 288 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2298689-2298976 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGCGGGAATTTAAAAAAATCGGGGTCATCTTGCCATTTCTTTTTCTCAGTGGCTGTATGTCATCACCAA
ACACGCTGAAGTCACTGCCAAAATGTGATGGATATTCTAAACGTCCACTCAACCGATCCATGTGGAATTG
GGAAGGGAAAAAACCAACGTCCACGCCCATTATCATCAGTAACAACACCCCCTCCCCTCAAAAAGAGGGA
AAGCTAGAAACGCTGCTGGCACAAAAACCAACGGATGAGGAAATGAAATCCTATAAAAATTGCGGGCAAA
AAGCATGA
 Primer design