SecReT4
Protein ID: 163869110
T4SS name [ID]VirB [226]
Gene symbolvblB8
Locus tagBtr_2342
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2298973..2299644 [+]
ProductVblB8 protein
Component typeVirB8
UniProt IDA9IYF7
KEGG IDbtr:Btr_2342
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.9e-62, Aligned region: 12..220
Protein Sequence: 223 a.a.     [Download]
>gi|163869110|ref|YP_001610348.1| VblB8 protein [Bartonella tribocorum CIP 105476]
MKQKDIEQYIAEARSFDQDRMLASRRTTRASLAIAAISVIVALISSLAVITLTPLKTVEPFVIRVDNSTG
ITEVVEALKEGPTNVDEAITRYFAAKYVRCREGFAVEEVQHNFQTVSLLSSPEEQERFASWYGARNPQSP
QILYKHASVTVTIKSISFINQDVAQVRYYRTIHDNENNKEFITHWVATLTFEYINAPISVQNRLINPLGF
IVNEYRTDPEVVN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2298973-2299644 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAACAAAAAGACATCGAACAATATATTGCTGAGGCGCGCTCTTTTGACCAAGACCGCATGCTCGCCT
CACGCCGCACCACCCGCGCTTCTCTCGCTATCGCTGCGATATCCGTTATCGTCGCGCTTATCTCCTCACT
CGCGGTCATCACCCTCACACCGCTTAAAACCGTAGAGCCTTTTGTCATCCGTGTGGACAATTCAACCGGT
ATCACAGAAGTCGTGGAAGCCTTAAAAGAAGGTCCCACAAACGTTGATGAAGCCATCACACGCTATTTTG
CCGCAAAATATGTACGCTGCCGTGAAGGCTTTGCCGTAGAAGAAGTACAACACAATTTCCAAACCGTCTC
TCTGCTCTCTTCTCCTGAAGAACAAGAAAGATTTGCCAGCTGGTACGGCGCAAGAAATCCACAAAGTCCT
CAAATTCTCTATAAACACGCCAGTGTCACCGTCACGATAAAATCAATCTCCTTTATCAATCAAGATGTTG
CTCAAGTGCGTTACTACAGAACAATCCATGACAATGAAAACAACAAAGAATTCATTACCCACTGGGTTGC
AACGCTCACCTTTGAATATATCAATGCCCCTATCTCTGTCCAAAACCGTTTGATAAATCCTCTTGGGTTT
ATTGTTAATGAATATAGAACTGATCCGGAAGTGGTCAACTGA
 Primer design