SecReT4
Protein ID: 163869113
T4SS name [ID]VirB [226]
Gene symbolvblB11
Locus tagBtr_2345
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2301793..2302848 [+]
ProductVblB11 protein
Component typeVirB11
UniProt IDA9IYG3
KEGG IDbtr:Btr_2345
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.9e-85, Aligned region: 19..331
DEAD [PF00270], Evalue: 9.5e-05, Aligned region: 175..231
Protein Sequence: 351 a.a.     [Download]
>gi|163869113|ref|YP_001610351.1| VblB11 protein [Bartonella tribocorum CIP 105476]
MMPTAKNAERASIVLTKLKILDDFLNNENLFEIVVNRPGEVIVEGPNGWQTHTIQELTYSELEGIAKVVA
AYTTQKISVENPVLSATLPNNERIQIVMPPAVAPNTISMTIRKPSSRTFSLESLNENQLFSVTQSVSFTP
LKQMKQRENELSDTEKELTDLFIAKNFCKFLERAVITQQNILISGKTGSGKTTLSKALIAKIPDYERILT
IEDTPELVVPHSNKVQLFYSKDNQGLAKAGAKELLESGLRMRPDRILLQELRDGTAFYYIRNVNSGHPGS
ITTVHASTALAAFEQMTLLVKESDGGGNLARDDIRGLLISMIDVIIQCKRLEGKFRVTEIYYDPFKRRDA
F
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2301793-2302848 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATTATGCCAACAGCAAAAAATGCAGAACGCGCCTCCATCGTTTTAACAAAATTAAAGATCTTAGATGACT
TCCTCAATAATGAAAATTTATTTGAAATTGTTGTCAATCGCCCTGGCGAAGTAATTGTCGAAGGTCCAAA
TGGTTGGCAAACCCACACCATACAAGAACTCACCTACAGCGAGCTAGAAGGCATTGCAAAAGTTGTTGCT
GCCTACACAACACAGAAGATTAGTGTAGAAAACCCTGTTCTCTCCGCAACACTTCCCAATAACGAACGCA
TACAAATTGTCATGCCCCCTGCTGTTGCCCCCAACACCATCAGCATGACCATTCGCAAACCCTCATCACG
CACTTTTTCCCTTGAAAGTTTAAACGAAAACCAGTTGTTCTCTGTCACACAAAGCGTCAGTTTCACCCCC
CTTAAACAAATGAAACAACGAGAAAATGAACTCTCCGATACAGAAAAAGAACTAACAGATCTCTTTATCG
CCAAAAACTTTTGTAAATTTTTAGAACGCGCCGTTATCACTCAACAAAACATCTTAATATCTGGAAAAAC
CGGTTCTGGAAAAACAACCCTCTCCAAAGCTTTAATTGCCAAAATCCCTGACTATGAACGCATTCTCACC
ATTGAAGACACCCCAGAACTGGTCGTTCCCCATTCCAACAAAGTGCAACTTTTTTATTCAAAAGATAACC
AAGGCTTAGCAAAAGCAGGCGCAAAAGAACTGCTTGAATCGGGCTTGCGCATGCGCCCCGATAGAATCCT
TCTACAAGAGCTGCGTGATGGTACAGCCTTTTACTATATCCGTAATGTCAACTCCGGTCACCCCGGCTCT
ATCACCACGGTGCACGCTTCAACAGCCCTTGCAGCCTTTGAACAAATGACTCTCCTTGTCAAAGAAAGTG
ACGGTGGGGGGAATTTAGCACGCGATGATATCCGCGGCTTATTAATCTCTATGATAGATGTCATCATCCA
ATGCAAACGTTTGGAAGGCAAATTTCGTGTAACAGAAATCTATTACGACCCCTTCAAACGCCGAGATGCT
TTTTAA
 Primer design