SecReT4
Protein ID: 163869214
T4SS name [ID]Trw [147]
Gene symboltrwN
Locus tagBtr_2509
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2441450..2442091 [+]
ProductTrwN protein
Component typeTrwN
UniProt IDA9IZ24
KEGG IDbtr:Btr_2509
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 213 a.a.     [Download]
>gi|163869214|ref|YP_001610466.1| TrwN protein [Bartonella tribocorum CIP 105476]
MIFSDFTMFAAAYISNTPHLAFSALIEQGARDNVDITSNNDKLFGQLSPLREETAITEQLKQNKHNFDAI
FEQIDVENMKWFSFFGAFGFCRDLADVQSALACCYKQKVSKCVFEKAALQSALSFYNTKGLNSGADTQTI
TSYIGVKAAAQEDKNLQDPVRLKKEEPEQVTKVDSLPLSSEELEDAFGHKESSSRDAFAAEGSSSSTEQL
SGN
 
Nucleotide Sequence: 642 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2441450-2442091 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGATTTTTTCAGATTTCACAATGTTTGCTGCGGCATACATATCCAATACCCCTCATTTAGCATTTTCAG
CTCTCATCGAACAAGGCGCACGGGATAATGTTGATATAACAAGCAATAATGATAAATTATTCGGTCAATT
ATCTCCACTTAGAGAAGAAACTGCAATAACTGAGCAGCTCAAACAAAATAAACATAATTTTGACGCAATC
TTTGAGCAAATTGATGTTGAAAATATGAAATGGTTTTCTTTTTTTGGGGCATTTGGCTTTTGCAGAGATC
TTGCAGATGTACAAAGTGCTTTAGCTTGCTGTTACAAACAAAAAGTATCAAAGTGTGTTTTTGAAAAAGC
GGCATTACAATCTGCGTTAAGTTTTTATAACACAAAAGGCTTAAACAGTGGTGCCGATACACAAACGATT
ACTTCATATATTGGAGTAAAAGCTGCTGCACAAGAAGATAAAAACTTGCAAGATCCTGTAAGGCTAAAGA
AAGAAGAACCAGAACAAGTAACTAAAGTAGATTCTCTTCCTCTTTCTTCAGAGGAATTAGAAGATGCGTT
TGGGCATAAAGAAAGTAGCAGCCGTGATGCTTTTGCTGCGGAAGGTTCTTCTTCATCGACCGAGCAGCTA
AGCGGTAATTGA
 Primer design