SecReT4
Protein ID: 163869216
T4SS name [ID]Trw [147]
Gene symboltrwL1
Locus tagBtr_2511
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2442474..2442791 [+]
ProductTrwL1 protein
Component typeTrwL
UniProt IDA9IZ28
KEGG IDbtr:Btr_2511
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.4e-13, Aligned region: 6..100
Protein Sequence: 105 a.a.     [Download]
>gi|163869216|ref|YP_001610468.1| TrwL1 protein [Bartonella tribocorum CIP 105476]
MKKSNTLQTIVHNKTIPISAALTVFFMDNFAYANPTTLINAKKALDGLKGDLKIIIPIAAGVILLCLAIA
YAGRYIEKSTFIRWAVGVVVAGSAHELATLLFTRS
 
Nucleotide Sequence: 318 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2442474-2442791 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAATCAAATACCCTTCAAACAATAGTTCATAATAAAACTATTCCAATATCTGCAGCTTTAACTG
TATTCTTTATGGATAATTTTGCATATGCTAACCCGACAACCTTGATAAATGCAAAGAAGGCTTTAGACGG
TTTAAAGGGCGATTTAAAAATTATCATCCCTATTGCCGCCGGTGTTATACTTTTATGTCTAGCAATTGCT
TATGCAGGGCGCTACATTGAAAAAAGTACGTTCATACGATGGGCAGTTGGCGTTGTTGTCGCTGGTTCAG
CACACGAACTTGCTACACTGTTATTTACTCGATCTTAA
 Primer design