SecReT4
Protein ID: 163869217
T4SS name [ID]Trw [147]
Gene symboltrwL2
Locus tagBtr_2512
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2442932..2443252 [+]
ProductTrwL2 protein
Component typeTrwL
UniProt IDA9IZ30
KEGG IDbtr:Btr_2512
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-18, Aligned region: 7..101
Protein Sequence: 106 a.a.     [Download]
>gi|163869217|ref|YP_001610469.1| TrwL2 protein [Bartonella tribocorum CIP 105476]
MKQLNILQTIVRKKNTPISAALTVFFMNNSAYANDPKTLTNAKKALEGLKGDLEKLIPIAAGVILLCLAI
AYAGRYIEKSTFIRWAVGVVIAGSASQLATLLFTGA
 
Nucleotide Sequence: 321 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2442932-2443252 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAACAATTAAATATTCTTCAAACAATAGTTCGTAAAAAAAATACTCCAATCTCTGCAGCTTTAACTG
TATTCTTTATGAATAATTCTGCATATGCTAATGACCCGAAAACTTTGACAAATGCAAAGAAGGCTTTAGA
GGGCTTAAAGGGCGATTTAGAAAAACTTATCCCTATTGCCGCTGGTGTTATACTTTTATGTCTAGCAATT
GCTTATGCGGGGCGATACATCGAAAAATCTACATTCATACGATGGGCAGTCGGGGTTGTTATCGCTGGTT
CAGCATCCCAACTTGCTACACTGTTATTTACTGGAGCTTAA
 Primer design