SecReT4
Protein ID: 163869218
T4SS name [ID]Trw [147]
Gene symboltrwL3
Locus tagBtr_2513
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2443390..2443707 [+]
ProductTrwL3 protein
Component typeTrwL
UniProt IDA9IZ32
KEGG IDbtr:Btr_2513
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.2e-17, Aligned region: 7..100
Protein Sequence: 105 a.a.     [Download]
>gi|163869218|ref|YP_001610470.1| TrwL3 protein [Bartonella tribocorum CIP 105476]
MKQLDILQTIVRKKNTSISTALTVFFMNNSAYAQPRYLTNANNALERLKGDLNIIIPIAAGVILLCLAIA
YAGRYIEKSTFIRWAVGVVVAGSASQLATLLFNRV
 
Nucleotide Sequence: 318 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2443390-2443707 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAACAATTAGATATTCTTCAAACAATAGTTCGTAAAAAAAACACTTCAATCTCTACAGCTTTAACTG
TATTCTTTATGAATAATTCCGCATATGCCCAACCGAGGTATTTGACAAATGCAAATAACGCTTTAGAGCG
CTTAAAGGGCGATTTAAACATTATTATCCCTATTGCCGCCGGTGTTATACTTTTATGTCTAGCAATTGCT
TATGCGGGGAGATACATCGAAAAAAGTACGTTCATACGATGGGCAGTTGGCGTTGTTGTAGCTGGTTCAG
CATCCCAACTTGCTACACTGTTATTTAATCGAGTTTAA
 Primer design