SecReT4
Protein ID: 163869219
T4SS name [ID]Trw [147]
Gene symboltrwL4
Locus tagBtr_2514
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2443848..2444168 [+]
ProductTrwL4 protein
Component typeTrwL
UniProt IDA9IZ34
KEGG IDbtr:Btr_2514
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2e-18, Aligned region: 6..101
Protein Sequence: 106 a.a.     [Download]
>gi|163869219|ref|YP_001610471.1| TrwL4 protein [Bartonella tribocorum CIP 105476]
MKKSNTLQTIVHNKTIPISAALTVFFMNNSAYASNPTTLTNAKTALDGLKSDLEKLIPIAAGVILLCLAI
AYAGRYIEKSTFIRWAVGVVIAGSASQLATLLFTRS
 
Nucleotide Sequence: 321 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2443848-2444168 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAATCAAATACCCTTCAAACAATAGTTCATAATAAAACTATTCCAATATCTGCAGCTTTAACTG
TATTCTTTATGAATAATTCTGCATATGCTAGTAACCCGACAACTCTGACAAATGCAAAGACAGCTTTAGA
CGGCTTGAAAAGTGACTTAGAAAAACTTATCCCTATTGCCGCTGGTGTTATACTTTTATGTCTAGCAATT
GCTTATGCGGGGCGATACATCGAAAAATCTACATTCATACGATGGGCAGTCGGGGTTGTTATCGCTGGTT
CAGCATCCCAACTTGCTACACTGTTATTTACTAGATCTTAA
 Primer design