SecReT4
Protein ID: 163869220
T4SS name [ID]Trw [147]
Gene symboltrwL5
Locus tagBtr_2515
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2444290..2444604 [+]
ProductTrwL5 protein
Component typeTrwL
UniProt IDA9IZ36
KEGG IDbtr:Btr_2515
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6e-16, Aligned region: 6..100
Protein Sequence: 104 a.a.     [Download]
>gi|163869220|ref|YP_001610472.1| TrwL5 protein [Bartonella tribocorum CIP 105476]
MKKSNTLQTIVRNKIIVSSAALTVFFMNNSAYAQVTHLTNAKTALEGLKGDLKIIIPIAAGVILLCLAIA
YAGRYIEKSTFIRWAVGVVVAGSAHELAQLLFTR
 
Nucleotide Sequence: 315 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2444290-2444604 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAATCAAATACCCTTCAAACAATAGTTCGTAATAAAATTATTGTGTCTTCTGCAGCTTTAACTG
TATTCTTTATGAATAATTCTGCATATGCCCAAGTGACGCATTTGACAAATGCAAAAACGGCTTTAGAGGG
CTTAAAGGGCGATTTAAAAATTATCATCCCTATTGCCGCTGGTGTTATACTTTTATGTCTAGCAATTGCT
TATGCAGGGCGCTACATCGAAAAAAGTACGTTCATACGATGGGCAGTTGGTGTTGTTGTCGCAGGTTCAG
CACACGAACTTGCTCAACTGTTATTTACTCGGTAA
 Primer design