SecReT4
Protein ID: 163869221
T4SS name [ID]Trw [147]
Gene symboltrwL6
Locus tagBtr_2516
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2444742..2445062 [+]
ProductTrwL6 protein
Component typeTrwL
UniProt IDA9IZ38
KEGG IDbtr:Btr_2516
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.4e-17, Aligned region: 6..101
Protein Sequence: 106 a.a.     [Download]
>gi|163869221|ref|YP_001610473.1| TrwL6 protein [Bartonella tribocorum CIP 105476]
MKKSNTLQTIVHNKTIPISAALTVFFMNNSAYATEPTTLKNAKKALDGLKDDLNKLIPIAAGVILLCLAI
AYAGRYIEKGTFIRWAVGVVIAGSAFQLATLLFSGK
 
Nucleotide Sequence: 321 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2444742-2445062 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAATCAAATACCCTTCAAACCATAGTTCATAATAAAACTATTCCAATATCTGCAGCTTTAACTG
TATTCTTTATGAATAATTCTGCGTATGCTACTGAGCCAACAACTTTGAAAAATGCAAAGAAGGCTTTAGA
TGGTTTAAAAGATGATTTAAACAAACTTATCCCTATTGCCGCTGGTGTTATACTTTTATGTCTAGCAATT
GCTTATGCAGGGCGCTACATCGAAAAAGGTACGTTCATACGATGGGCAGTTGGCGTTGTTATTGCTGGTT
CAGCATTCCAACTTGCTACACTGTTATTTTCAGGTAAATAA
 Primer design