SecReT4
Protein ID: 163869222
T4SS name [ID]Trw [147]
Gene symboltrwL7
Locus tagBtr_2516a
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2445194..2445505 [+]
ProductTrwL7 protein
Component typeTrwL
UniProt IDA9IZ40
KEGG IDbtr:Btr_2516a
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 103 a.a.     [Download]
>gi|163869222|ref|YP_001610474.1| TrwL7 protein [Bartonella tribocorum CIP 105476]
MKQLNTFQRKIYNKFSVIFITSMMLLITRFSYAQTETKSIDVFIGVQYGLSVLVPIVAIIVFLFLLLIYI
FRIIAKATFIRWAFSVIIAGAAFYISHILFHLQ
 
Nucleotide Sequence: 312 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2445194-2445505 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAGCAATTAAATACATTTCAAAGAAAAATATACAACAAGTTTAGTGTTATTTTTATCACTTCAATGA
TGTTGTTAATAACTCGATTTTCTTATGCTCAAACGGAAACAAAGAGCATAGATGTTTTTATTGGTGTGCA
ATATGGATTGAGTGTACTTGTTCCTATCGTTGCTATCATCGTTTTTTTGTTTCTTTTGCTTATTTATATA
TTTCGCATCATTGCAAAAGCTACGTTTATACGATGGGCGTTTAGCGTTATTATTGCTGGTGCAGCCTTCT
ATATTAGTCACATATTATTTCACCTCCAGTGA
 Primer design