SecReT4
Protein ID: 163869225
T4SS name [ID]Trw [147]
Gene symboltrwJ1
Locus tagBtr_2519
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2448297..2449046 [+]
ProductTrwJ1 protein
Component typeTrwJ
UniProt IDA9IZ45
KEGG IDbtr:Btr_2519
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.1e-53, Aligned region: 28..228
Protein Sequence: 249 a.a.     [Download]
>gi|163869225|ref|YP_001610477.1| TrwJ1 protein [Bartonella tribocorum CIP 105476]
MKKQVISIAVAITLGVLNPAKAFIVGGVPDSSSLYKFFGGSYSNAPEPEVTIPKKKVHPVTPLLDILRKQ
LEQTKKIHDSITGNQKFDTEKLKMNQTDNTSFFLKNPETLYNKNTYSTLSSSLKNILKEEEIPASIHESS
DFINKRIQYAAITDKAVSLKTFQEASNRFQQIEELLNEIKTTKDLKSMAELQAHIIGMLAKLQNETAKLQ
MVTHLRNAEYTLIKQQKDRHNIRILNSKNTKMPTIKFIR
 
Nucleotide Sequence: 750 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2448297-2449046 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAGAAACAGGTCATTTCGATAGCAGTAGCAATAACTTTAGGGGTTTTGAATCCAGCAAAAGCTTTTA
TAGTTGGAGGGGTCCCAGATTCATCTTCATTGTATAAATTTTTTGGAGGTTCATATTCAAACGCACCAGA
GCCTGAAGTTACTATACCAAAAAAGAAAGTACACCCAGTTACCCCACTTCTCGATATACTTAGAAAACAA
CTTGAACAAACAAAAAAAATTCATGATTCTATAACGGGAAATCAGAAATTCGATACTGAAAAACTCAAAA
TGAATCAAACAGATAACACCAGTTTTTTTCTCAAAAATCCAGAAACACTCTATAATAAAAATACTTATTC
AACTCTATCTTCATCACTTAAAAATATTTTAAAAGAAGAAGAAATTCCCGCCTCTATCCATGAATCTAGC
GATTTCATCAACAAGCGTATCCAATATGCCGCCATCACGGATAAAGCTGTGAGTTTAAAGACTTTTCAAG
AAGCAAGCAATCGTTTTCAGCAAATTGAAGAACTATTGAACGAAATCAAGACAACAAAAGATCTAAAAAG
TATGGCCGAGTTACAAGCACATATCATTGGAATGCTTGCTAAACTACAAAATGAAACAGCAAAACTACAA
ATGGTTACACATTTACGCAACGCTGAATATACACTTATCAAACAGCAGAAAGATAGACATAACATAAGAA
TTCTGAATAGTAAAAATACAAAAATGCCTACTATAAAATTTATTCGATAG
 Primer design