SecReT4
Protein ID: 163869227
T4SS name [ID]Trw [147]
Gene symboltrwH1
Locus tagBtr_2521a
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2450239..2450460 [+]
ProductTrwH1 protein
Component typeTrwH
UniProt IDA9IZ47
KEGG IDbtr:Btr_2521a
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|163869227|ref|YP_001610479.1| TrwH1 protein [Bartonella tribocorum CIP 105476]
MLYFIIKIIIMIRNAGLLIVKKRSVKVKSVVFIILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKR
GDR
 
Nucleotide Sequence: 222 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2450239-2450460 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGCTTTACTTTATTATTAAAATTATAATAATGATAAGAAATGCTGGGCTTTTAATTGTCAAAAAGAGGA
GTGTTAAGGTAAAGTCGGTTGTTTTTATAATTTTGATTGCAAATCTTTTATCGGCTTGTGCATTAGCACC
AAAGCTAAAACAACCTAATGATAGAAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATCAAGCGA
GGAGACAGATGA
 Primer design