SecReT4
Protein ID: 163869228
T4SS name [ID]Trw [147]
Gene symboltrwJ2
Locus tagBtr_2522
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2450457..2451389 [+]
ProductTrwJ2 protein
Component typeTrwJ
UniProt IDA9IZ48
KEGG IDbtr:Btr_2522
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.6e-27, Aligned region: 126..293
Protein Sequence: 310 a.a.     [Download]
>gi|163869228|ref|YP_001610480.1| TrwJ2 protein [Bartonella tribocorum CIP 105476]
MKKQFIIIGVISLLEMMNLAHANNAGFHNRDTYDRTQGRLMEGGKYRKYPGLSDSTHNRDVTITKRPNRP
RVKKKPAPPKRSRPAHPPQPTPLPQPTPLPQPAQPPQPALSKEYSEILQLLKKGEIIELLKKQLDSKRQQ
LSQVEKAYQAITKSQKTNPKQIDFSSFFLKEPEFLYKDSKLSRQSYQEVLEEENKVSGNFDQISKAIFGR
LQSVSVQDKAVSLESFENVKSRFQYLRGLLDELQTKEKLKDIADLQAHIDGTLAMIQNEFIKMEMVAYLH
DAEQSLIKRKRRELDMMFFDHEKNQMPIIR
 
Nucleotide Sequence: 933 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2450457-2451389 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAGCAATTTATTATAATAGGAGTGATTAGCCTTTTGGAAATGATGAATTTGGCGCATGCAAATA
ACGCAGGTTTTCATAATAGAGATACTTATGATAGAACTCAAGGAAGGTTAATGGAAGGAGGTAAATATCG
GAAATATCCTGGCTTGTCGGATTCAACACACAATAGAGATGTTACTATAACTAAACGTCCTAATAGACCA
AGAGTTAAAAAAAAGCCAGCACCACCTAAAAGGTCACGACCTGCTCATCCACCACAACCTACTCCATTGC
CACAACCTACTCCATTGCCACAACCTGCTCAACCGCCACAACCTGCTCTATCAAAAGAATATTCGGAAAT
CCTTCAGCTTTTAAAAAAAGGGGAAATTATTGAGCTCTTAAAAAAACAGCTTGACTCGAAAAGACAACAA
CTTTCACAAGTAGAAAAAGCTTATCAGGCTATAACAAAGAGTCAGAAAACAAACCCAAAGCAAATAGACT
TTTCTAGTTTTTTTCTTAAAGAGCCAGAATTTCTCTATAAAGATAGTAAGCTTTCAAGGCAATCATATCA
AGAGGTCTTGGAGGAAGAAAACAAAGTTTCTGGGAATTTTGATCAAATCAGCAAAGCTATTTTTGGGCGT
TTACAATCTGTATCGGTTCAAGATAAAGCTGTGAGTTTGGAAAGTTTTGAAAACGTAAAAAGTCGTTTTC
AATACCTCAGAGGACTACTCGATGAGCTTCAAACAAAAGAAAAACTGAAAGACATTGCAGACCTTCAAGC
ACATATCGATGGTACATTAGCTATGATCCAAAATGAATTTATAAAAATGGAAATGGTAGCGTATTTACAT
GACGCTGAGCAATCACTTATCAAAAGGAAAAGACGCGAACTTGATATGATGTTTTTTGACCATGAAAAAA
ACCAGATGCCGATCATACGGTGA
 Primer design