SecReT4
Protein ID: 163869231
T4SS name [ID]Trw [147]
Gene symboltrwJ3
Locus tagBtr_2524
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2452798..2453529 [+]
ProductTrwJ3 protein
Component typeTrwJ
UniProt IDA9IZ53
KEGG IDbtr:Btr_2524
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 8.6e-24, Aligned region: 57..226
Protein Sequence: 243 a.a.     [Download]
>gi|163869231|ref|YP_001610483.1| TrwJ3 protein [Bartonella tribocorum CIP 105476]
MKKQFIIVGVIILEGMLNLIPANANATVTFESSSSSQTPVGSTSSLPTQSVPSEKYLEIIALLKKDLELK
KEQLSQIENAYQAITKDQKTTPRQIDFSNFFLKEPGLLYKDSKLSGKSYQDVLNSENRNSQLFDPLGKML
FARLQFISVMDKAITLKTFQNVENRFQYLKKLFDELQTKEKLKDIADLQAHIDGTLAMIQNESIKMQMVA
YLRKAEQSLIKRKRRELDMKFFNHEKNQMPIIR
 
Nucleotide Sequence: 732 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2452798-2453529 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAGCAATTTATTATAGTAGGGGTGATTATTTTGGAAGGAATGCTGAATTTAATTCCAGCAAATG
CAAATGCAACCGTAACTTTCGAATCCTCATCATCCTCACAAACACCCGTAGGCTCAACATCTTCTCTACC
GACACAATCTGTTCCATCAGAAAAATATCTGGAAATTATTGCGTTGTTAAAAAAAGACCTTGAGTTGAAA
AAAGAACAACTTTCACAAATAGAAAATGCCTATCAGGCTATAACAAAGGATCAAAAAACCACCCCGAGAC
AAATAGACTTTTCTAATTTTTTTCTTAAAGAGCCAGGATTGCTCTACAAAGATAGTAAGCTTTCAGGAAA
GTCATATCAAGACGTCTTGAATAGTGAAAACAGAAATTCTCAGCTTTTTGATCCACTCGGTAAAATGCTT
TTTGCGCGTTTACAATTTATATCGGTTATGGATAAAGCTATAACTTTAAAAACTTTTCAAAACGTAGAAA
ATCGTTTTCAATACCTCAAAAAATTATTCGATGAACTTCAAACAAAAGAAAAACTAAAAGACATTGCAGA
CCTTCAAGCACATATCGATGGTACATTAGCTATGATCCAAAATGAATCTATAAAGATGCAAATGGTAGCG
TATTTACGTAAAGCTGAGCAATCACTTATCAAAAGGAAAAGACGCGAACTTGATATGAAATTTTTTAACC
ATGAAAAAAACCAGATGCCGATCATACGGTGA
 Primer design