SecReT4
Protein ID: 163869233
T4SS name [ID]Trw [147]
Gene symboltrwJ4
Locus tagBtr_2526
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2454760..2455536 [+]
ProductTrwJ4 protein
Component typeTrwJ
UniProt IDA9IZ57
KEGG IDbtr:Btr_2526
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.2e-42, Aligned region: 42..240
Protein Sequence: 258 a.a.     [Download]
>gi|163869233|ref|YP_001610485.1| TrwJ4 protein [Bartonella tribocorum CIP 105476]
MLGFLIVKKSNIKMKKRFIIIGMITLLGMINLTLTSNLSWSSGAQGSTVQIASSTEYLKIIELLKEKIKV
TEEQIDNAKKVYQSIKGSRVTELRIKGGGDFFLHDMPVYAELKDYHNKNMDHYPNIKDIAYSVYREEQRA
NFWSFSPNKMREIINKRLQYSGIVSKAVSLQTFKDAENRFTQIINFLNEIDRTMNLAEVFELQTRIRNMS
SMLQNEYAKLQMVRNLRDNEELLIDIQKRKLYGKIISYQLTSMPRVRL
 
Nucleotide Sequence: 777 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2454760-2455536 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGCTGGGCTTTTTAATTGTCAAAAAGAGTAATATTAAAATGAAAAAACGATTTATTATAATAGGAATGA
TTACCCTTTTAGGAATGATAAATTTAACTCTAACGTCTAACCTGAGTTGGAGTTCTGGCGCTCAGGGTTC
AACTGTCCAAATCGCTTCCTCAACAGAATATCTAAAAATTATTGAGTTGTTAAAAGAAAAAATTAAAGTA
ACCGAAGAGCAGATCGATAACGCGAAAAAAGTCTATCAATCTATAAAAGGAAGTAGAGTAACGGAACTAA
GAATAAAAGGGGGTGGGGATTTTTTCTTACACGATATGCCTGTCTACGCAGAACTAAAAGACTACCATAA
CAAAAATATGGATCATTATCCCAATATCAAAGATATTGCATATTCTGTTTATCGTGAAGAGCAAAGGGCA
AACTTCTGGTCGTTTTCGCCTAATAAGATGCGGGAGATAATTAATAAGCGCCTTCAATATAGTGGCATTG
TGAGTAAAGCCGTAAGCTTGCAAACTTTCAAAGACGCAGAGAACCGCTTTACGCAAATTATCAATTTCTT
AAATGAGATAGATAGAACAATGAATCTGGCGGAAGTTTTTGAGCTGCAAACACGCATCAGGAACATGTCA
TCCATGCTCCAAAATGAATATGCAAAGTTACAAATGGTCAGAAATTTACGCGATAATGAAGAGCTCCTTA
TCGACATACAAAAACGTAAATTGTATGGAAAAATAATAAGCTATCAGCTCACAAGTATGCCTAGGGTAAG
ACTTTAG
 Primer design