SecReT4
Protein ID: 163869235
T4SS name [ID]Trw [147]
Gene symboltrwH4
Locus tagBtr_2527a
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2456842..2456985 [+]
ProductTrwH4 protein
Component typeTrwH
UniProt IDA9IZ51
KEGG IDbtr:Btr_2523a, btr:Btr_2527a, btr:Btr_2529a
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|163869235|ref|YP_001610487.1| TrwH4 protein [Bartonella tribocorum CIP 105476]
MKSVVFIILIANLLSACALAPKLKQPNDRNRVPINKTIPAEIKRGDR
 
Nucleotide Sequence: 144 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2456842-2456985 Bartonella tribocorum CIP 105476 chromosome, complete genome
GTGAAGTCGGTCGTTTTTATAATTTTGATTGCAAATCTTTTATCGGCTTGTGCATTAGCACCAAAGCTAA
AACAACCTAATGATAGAAACCGTGTGCCTATTAATAAAACAATCCCTGCCGAAATTAAGCGAGGAGACAG
ATGA
 Primer design