SecReT4
Protein ID: 163869236
T4SS name [ID]Trw [147]
Gene symboltrwJ5
Locus tagBtr_2528
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2456982..2457833 [+]
ProductTrwJ5 protein
Component typeTrwJ
UniProt IDA9IZ63
KEGG IDbtr:Btr_2528
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.5e-27, Aligned region: 100..266
Protein Sequence: 283 a.a.     [Download]
>gi|163869236|ref|YP_001610488.1| TrwJ5 protein [Bartonella tribocorum CIP 105476]
MKKQFIIIGVITLLGMMSLAHASGSPQTYTCNFLELGLAEYQKNTFGADLTGILEKCAQSPSPTPPPQPA
PPPQPAPPPQPALPEEYSEILQLLKKGEIIELLKKQLDSKRQQLSQVEKAYQAITKSQKTNPKQIDFSSF
FLKEPEFLYTDSKLSRQSYREVLEEENKVSGNFDQISKAIFGRLQSVSVQDKAVSLESFENVKSRFQYLR
GLLDELQTKEKLKDIADLQAHIDGTLAMIQNEFIKMEMVAYLHDAEQSLIKRKRRELDMMFFDHEKNQMP
IIR
 
Nucleotide Sequence: 852 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2456982-2457833 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAGCAATTTATTATAATAGGGGTGATTACCCTTTTGGGAATGATGAGTTTGGCGCATGCATCGG
GTTCTCCTCAAACATATACATGCAATTTTCTAGAGTTGGGACTTGCAGAATATCAAAAGAATACATTTGG
AGCAGACCTCACTGGAATCCTAGAAAAATGTGCACAATCTCCATCACCTACTCCACCGCCACAACCTGCC
CCACCGCCACAACCTGCCCCACCACCACAACCTGCTCTACCAGAAGAATATTCGGAAATCCTTCAGCTTT
TAAAAAAAGGAGAAATTATTGAGCTCTTAAAAAAACAACTTGACTCGAAAAGACAACAACTTTCACAAGT
AGAAAAAGCTTATCAGGCTATAACAAAGAGTCAGAAAACAAACCCAAAGCAAATAGACTTTTCTAGTTTT
TTTCTTAAAGAGCCAGAATTTCTCTATACAGACAGTAAGCTTTCAAGGCAATCGTATCGAGAGGTCTTGG
AGGAAGAAAACAAAGTTTCTGGGAATTTTGATCAAATCAGCAAAGCTATTTTTGGGCGTTTACAATCTGT
ATCGGTTCAAGATAAAGCTGTGAGTTTGGAAAGTTTTGAAAACGTAAAAAGTCGTTTTCAATACCTCAGA
GGACTACTCGATGAGCTTCAAACAAAAGAAAAACTGAAAGACATTGCAGACCTTCAAGCACATATCGATG
GTACATTAGCTATGATCCAAAATGAATTTATAAAAATGGAAATGGTAGCGTATTTACATGACGCTGAGCA
ATCACTTATCAAAAGGAAAAGACGCGAACTTGATATGATGTTTTTTGACCATGAAAAAAACCAGATGCCG
ATCATACGGTGA
 Primer design