SecReT4
Protein ID: 163869239
T4SS name [ID]Trw [147]
Gene symboltrwG
Locus tagBtr_2530
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2459242..2459943 [+]
ProductTrwG protein
Component typeTrwG
UniProt IDA9IZ69
KEGG IDbtr:Btr_2530
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.4e-52, Aligned region: 22..228
Protein Sequence: 233 a.a.     [Download]
>gi|163869239|ref|YP_001610491.1| TrwG protein [Bartonella tribocorum CIP 105476]
MKTKQAKPVKAEQLSSYYEESRGLERDLINEFIRSRRTAWRVASAVGLFGLFGMICGVVGFSQPAPTPLV
LRVDNTTGAVDVISIMREHEESYGEVVDRYWLNQYVLNRETYDYDTIQLNYGTTALLSAAAVQQEYYKIY
DGENARDKVLSNRARITVKVRSIQPNGLGQATVRFTTQQLDSSGAANGPKQHQIATIGYTYVGAPMKSSD
RLLNPLGFQVTSYRSDPEILLND
 
Nucleotide Sequence: 702 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2459242-2459943 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAACAAAACAAGCAAAACCAGTGAAAGCTGAACAACTTAGCAGTTATTACGAAGAGAGTCGTGGTC
TAGAAAGGGATCTCATAAACGAATTTATAAGGTCGCGCAGAACAGCATGGCGTGTAGCGAGTGCTGTTGG
TCTTTTTGGCTTATTCGGTATGATATGTGGGGTTGTTGGATTTTCTCAACCAGCGCCTACACCTTTAGTG
TTACGCGTTGATAACACAACAGGTGCTGTTGATGTTATCTCAATTATGCGTGAGCACGAAGAAAGCTATG
GTGAAGTTGTAGATAGATATTGGCTCAATCAATATGTGCTTAACCGCGAAACTTATGACTATGATACCAT
TCAACTAAACTATGGCACAACAGCTCTTTTAAGTGCAGCAGCTGTTCAACAAGAATATTATAAAATCTAT
GATGGGGAAAATGCACGGGATAAAGTGCTTTCAAACAGAGCACGTATCACAGTTAAAGTACGGTCAATTC
AACCTAATGGACTCGGTCAAGCAACCGTACGTTTTACGACTCAACAACTTGATAGCAGCGGTGCTGCTAA
TGGACCAAAACAGCACCAGATTGCAACAATTGGTTACACCTATGTGGGTGCACCTATGAAATCATCTGAT
CGATTGCTTAACCCCCTTGGTTTTCAGGTAACAAGTTACCGTTCTGACCCAGAAATACTGTTGAATGATT
AA
 Primer design