SecReT4
Protein ID: 163869240
T4SS name [ID]Trw [147]
Gene symboltrwF
Locus tagBtr_2531
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2459957..2460763 [+]
ProductTrwF protein
Component typeTrwF
UniProt IDA9IZ71
KEGG IDbtr:Btr_2531
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.4e-61, Aligned region: 33..242
Protein Sequence: 268 a.a.     [Download]
>gi|163869240|ref|YP_001610492.1| TrwF protein [Bartonella tribocorum CIP 105476]
MKKLAFVVLLSSFSSLYTVPVQALKSPTNSQYDHRIRYITYNEADVVQIETVLGVATHIILEEGEQYITH
AFGDSEAYAFAHKGRHIFIKPKAELANTNLIVVTDKRSYKFRLQFRNDRAGSTYELAFHYPDSNDEKSEE
NNRRLAIERGFHQSVKGYNLSYTMSGHQDIAPINAWDNGRITYFKFPANMDMPSIYVVDAEGNESLIPRT
VIGSSNDIIAVHKVNPKWLIRLGKRALAVFNEAYDPHGIPNTTGTVSSVVYRINKGGK
 
Nucleotide Sequence: 807 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2459957-2460763 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGAAAAAACTTGCATTCGTTGTTCTATTATCTTCATTTTCTTCTCTTTATACAGTACCTGTACAGGCGC
TCAAAAGTCCGACAAATTCGCAATATGATCACCGCATTCGTTATATAACATATAACGAAGCCGATGTAGT
TCAAATTGAGACAGTTCTTGGTGTGGCAACACATATTATTCTTGAAGAAGGTGAACAGTATATCACTCAT
GCCTTTGGTGATTCAGAAGCCTATGCCTTTGCTCATAAAGGGCGGCATATTTTTATTAAACCAAAAGCAG
AACTTGCCAATACCAATCTCATCGTTGTAACGGACAAACGGAGTTACAAATTCCGACTACAATTTCGAAA
TGACCGTGCAGGATCAACCTATGAATTGGCTTTTCATTATCCCGATTCAAACGATGAAAAGTCAGAAGAA
AACAACCGACGCCTTGCGATTGAACGCGGTTTTCACCAAAGCGTAAAAGGTTATAATCTTAGTTATACCA
TGAGCGGTCATCAAGATATTGCTCCGATCAATGCTTGGGACAATGGACGTATTACTTACTTCAAGTTTCC
TGCTAACATGGATATGCCATCAATCTATGTCGTAGATGCTGAAGGGAATGAAAGCTTAATTCCACGCACC
GTCATCGGCAGTTCTAATGATATTATCGCCGTTCATAAGGTCAATCCTAAATGGCTCATACGACTTGGTA
AACGTGCTCTAGCTGTTTTTAACGAAGCCTATGATCCCCATGGTATACCAAACACAACAGGAACAGTATC
TTCGGTGGTTTACCGCATAAATAAAGGAGGAAAATAA
 Primer design