SecReT4
Protein ID: 163869241
T4SS name [ID]Trw [147]
Gene symboltrwE
Locus tagBtr_2532
StrainBartonella tribocorum CIP 105476
Repliconchromosome [GenBank: NC_010161] [Browse all T4SS(s) in this replicon]
Location [Strand]2460763..2461905 [+]
ProductTrwE protein
Component typeTrwE
UniProt IDA9IZ73
KEGG IDbtr:Btr_2532
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.7e-60, Aligned region: 192..371
Protein Sequence: 380 a.a.     [Download]
>gi|163869241|ref|YP_001610493.1| TrwE protein [Bartonella tribocorum CIP 105476]
MFDNKEGDEKGKKLDNIEQKHIENAYESSELGSEHRPTIPGTRVLLIVGLIVIVAVPIALTWKAFKMRNT
VEIEEEKPQQTVQQIIPSYTPRVIEEPKLVEESEKSTPIEDSSLDISPALAKLLQTTVPPHMIQDSEELA
RRRMLSSSLNNGGSEGSTETNKASNDNSGALNLQPVRLGQSHAAQLRNRDLLITQGTQIDCTLETKIITS
QPGMTTCHLTRDIYSTSGRVVLLDRGSKVVGFYQSGLQQGQTRVFVQWLRIETPSGVIVNLDSPGTGPLG
EAGIGGWVDRHFWERFSGAIMVSIIGDLGEWVRGKINKSSKENKENAQPQGAHNAELIVNDVIQNSINIT
PTLYKHQGERVNIFVARDLDFSDVYSLVTR
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|163867306|ref|NC_010161.1|:2460763-2461905 Bartonella tribocorum CIP 105476 chromosome, complete genome
ATGTTTGACAATAAGGAAGGAGATGAAAAAGGCAAAAAACTGGACAATATAGAGCAAAAACATATTGAAA
ATGCCTATGAAAGCTCCGAACTAGGTTCAGAGCACCGTCCGACAATTCCAGGTACCCGTGTATTATTAAT
CGTAGGACTTATTGTCATCGTAGCGGTACCAATTGCTTTGACTTGGAAAGCTTTTAAAATGCGTAATACC
GTAGAAATTGAGGAAGAAAAACCGCAACAAACGGTACAGCAAATTATACCAAGCTATACCCCGCGGGTTA
TAGAAGAGCCAAAGCTTGTAGAAGAATCAGAAAAATCAACACCAATAGAAGACTCAAGCCTAGATATTTC
ACCGGCCTTGGCTAAGCTTCTTCAAACAACCGTTCCCCCACATATGATTCAAGATTCTGAAGAATTAGCG
CGCAGACGTATGCTCAGTTCTAGTCTTAACAATGGTGGAAGTGAAGGATCTACGGAGACAAATAAAGCAT
CGAATGACAACAGTGGTGCATTAAATCTCCAACCTGTACGCTTAGGTCAATCACATGCGGCGCAACTTCG
TAACCGTGATCTCTTAATTACGCAAGGAACGCAAATAGATTGTACGTTGGAAACAAAAATTATTACCTCA
CAACCAGGGATGACAACATGTCATTTAACGCGGGATATTTATTCTACAAGTGGTCGTGTTGTTTTGCTCG
ATCGTGGTTCTAAAGTCGTTGGTTTTTACCAAAGTGGCTTACAGCAAGGGCAAACACGTGTTTTTGTGCA
ATGGTTACGTATTGAAACGCCTTCTGGTGTTATTGTCAATCTTGACTCACCTGGGACCGGTCCTCTTGGT
GAAGCAGGTATCGGTGGCTGGGTTGATAGACACTTTTGGGAGCGGTTTAGTGGCGCAATTATGGTGAGTA
TCATCGGTGATTTAGGAGAATGGGTGAGAGGTAAAATTAATAAAAGTAGCAAAGAGAATAAAGAGAACGC
ACAGCCACAAGGAGCTCATAATGCTGAACTTATAGTAAACGATGTTATTCAAAATTCAATCAATATAACA
CCAACACTTTACAAACACCAAGGCGAACGAGTAAATATTTTTGTTGCTCGTGATCTGGATTTCAGCGATG
TCTACAGTCTCGTCACACGTTAA
 Primer design