SecReT4
Protein ID: 16519686
T4SS name [ID]Trb [254]
Gene symboltrbC
Locus tagNGR_a04200
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234a [GenBank: NC_000914] [Browse all T4SS(s) in this replicon]
Location [Strand]533475..533858 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDP55396
KEGG IDrhi:NGR_a04200
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.6e-20, Aligned region: 3..99
Protein Sequence: 127 a.a.     [Download]
>gi|16519686|ref|NP_443806.1| conjugal transfer protein TrbC [Sinorhizobium fredii NGR234]
MSRKNEFISIALLASPLILASVAPALASSGGSLPWEGPLEQIQESITGPVAGYIALAAVAIAGGMLIFGG
ELNDFARRLMYVVLVAGILLGATTIVGLFGATGASIGLTNDRATSTRPSAEGEGAHG
 
Nucleotide Sequence: 384 bp     [Download]
>gi|255767010|ref|NC_000914.2|:c533858-533475 Sinorhizobium fredii NGR234 plasmid pNGR234a, complete sequence
ATGTCGCGTAAGAATGAATTTATCTCCATCGCGCTTCTTGCTTCGCCACTCATTTTGGCGTCGGTAGCAC
CGGCACTGGCCAGTTCAGGCGGCAGTCTGCCCTGGGAAGGACCGCTCGAGCAGATCCAGGAGTCCATCAC
GGGGCCAGTCGCGGGCTACATAGCACTTGCGGCAGTCGCGATCGCCGGCGGCATGCTGATTTTCGGCGGT
GAGCTGAACGATTTCGCGCGGCGGCTGATGTATGTCGTGCTTGTTGCCGGCATCCTCCTCGGCGCCACGA
CCATTGTCGGCCTGTTCGGCGCGACCGGCGCTTCGATCGGCCTGACCAATGATCGCGCCACTTCGACGCG
CCCGAGTGCAGAAGGGGAGGGGGCACATGGCTGA
 Primer design