SecReT4
Protein ID: 16519692
T4SS name [ID]Trb [254]
Gene symboltrbL
Locus tagNGR_a04140
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234a [GenBank: NC_000914] [Browse all T4SS(s) in this replicon]
Location [Strand]528577..529752 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDP55402
KEGG IDrhi:NGR_a04140
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.6e-32, Aligned region: 62..276
Protein Sequence: 391 a.a.     [Download]
>gi|16519692|ref|NP_443812.1| conjugal transfer protein TrbL [Sinorhizobium fredii NGR234]
MVKISLARSLLIAGLAYVAFEARAFAQEGLVLTELENHVSAAAKGWETTILDAAKSLFWILATIEIGIAA
VWLALQAASLDSWFAELVRRIMFVGFFAFVLTQGPTFARAVIDSLFQIGAGGGSASPAEIFDAGIRVASQ
MSQQAQFGVFEDNALAIAAVLAMGVVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAVRY
LVYAFGVGMKLMALVMIAKIGSQVLLGLANAPTASSDQFVTTLAIAGISVVVFIIAMYVPSIIQGVVQGA
SVSGGMETIRHGGQAASFAAGAGFLAGGAARTGFTAGQSARAAGSSLAGAALRGFGAGIGSASSAAGSAA
KEKAIGSPGAYAGSILGLANAKLDESRGGHSGHKPPPERKD
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|255767010|ref|NC_000914.2|:c529752-528577 Sinorhizobium fredii NGR234 plasmid pNGR234a, complete sequence
ATGGTGAAGATCAGTCTTGCACGTTCGTTGCTGATTGCAGGCTTGGCTTATGTCGCCTTCGAGGCACGCG
CTTTCGCGCAGGAAGGTCTAGTCCTCACGGAGTTGGAGAACCACGTCTCGGCAGCCGCGAAAGGATGGGA
AACCACCATCCTTGACGCGGCGAAATCGTTGTTTTGGATTTTGGCCACCATCGAGATCGGCATCGCGGCC
GTCTGGCTGGCGCTCCAGGCGGCTTCGCTCGACAGCTGGTTTGCTGAGCTTGTCCGGCGGATCATGTTCG
TCGGATTTTTTGCTTTCGTTCTGACGCAGGGCCCGACCTTCGCGCGCGCCGTGATCGATAGCCTGTTCCA
GATCGGCGCTGGCGGCGGATCGGCATCCCCCGCTGAAATCTTCGACGCTGGCATTCGGGTCGCCTCACAA
ATGTCGCAGCAAGCCCAGTTCGGCGTCTTCGAGGACAATGCGCTCGCAATCGCTGCGGTGCTGGCGATGG
GTGTCGTGGTCATCTGCTTTTCGCTGGTTGCAGCAATTTTCGTGTCGGTCATGGTCGAGATGTATGTCGG
CCTGCTCGCTGGCATGATCATGCTTGGGCTTGGCGGTTCCTCTTTCACGAAAGACTTCGCTGTCCGATAT
CTTGTCTATGCCTTCGGCGTCGGCATGAAACTGATGGCGCTCGTGATGATAGCTAAGATTGGATCGCAGG
TCCTCTTGGGCCTGGCGAATGCTCCAACCGCGTCTTCCGACCAATTTGTCACGACCCTGGCGATCGCCGG
CATCTCCGTCGTGGTTTTCATCATCGCCATGTACGTGCCGAGCATCATCCAAGGTGTAGTGCAAGGCGCC
TCGGTTTCCGGGGGGATGGAAACGATCCGTCACGGCGGCCAGGCGGCATCCTTCGCCGCCGGCGCTGGGT
TCCTCGCGGGCGGCGCCGCGAGAACGGGTTTCACGGCCGGTCAGTCGGCACGAGCGGCGGGTTCATCCCT
CGCCGGCGCGGCGCTTCGGGGTTTCGGCGCGGGGATCGGATCCGCCAGCAGTGCTGCTGGTTCTGCCGCC
AAGGAAAAGGCGATCGGTTCACCCGGCGCCTATGCCGGATCAATCCTCGGCCTCGCCAACGCCAAGCTCG
ATGAGAGCCGGGGCGGTCATAGCGGGCACAAGCCACCTCCCGAACGCAAAGACTAA
 Primer design