SecReT4
Protein ID: 16519694
T4SS name [ID]Trb [254]
Gene symboltrbG
Locus tagNGR_a04120
StrainSinorhizobium fredii NGR234
Repliconplasmid pNGR234a [GenBank: NC_000914] [Browse all T4SS(s) in this replicon]
Location [Strand]527061..527873 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDP55404
KEGG IDrhi:NGR_a04120
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.4e-57, Aligned region: 57..268
Protein Sequence: 270 a.a.     [Download]
>gi|16519694|ref|NP_443814.1| conjugal transfer protein TrbG [Sinorhizobium fredii NGR234]
MHRTGLIAAAGCLATLVFASAAEAQSMTTNEVKGTSISRKWRGTAGLVTTGPDGKVIFLFGETQPSVVCS
PLQVCDIELQGGEIVRDVLVGDSVRWKVEPATSGATGGQAIHLIVKPSEPGLVTSMVVTTSRRTYHIQLK
SHPSQYMARVGFEYPEDVSTKLADINSRLETGGIPGTAPDKLNFSYSVSGSAPWKPKRVYSDGAKTYVQF
SKSISGQDAPVLFVVSGGQNRIVNYRMNNDMMIVDYAVDKAILVSGVGWRQQKITIRRGG
 
Nucleotide Sequence: 813 bp     [Download]
>gi|255767010|ref|NC_000914.2|:c527873-527061 Sinorhizobium fredii NGR234 plasmid pNGR234a, complete sequence
ATGCACAGAACCGGATTGATCGCAGCCGCCGGCTGCCTGGCAACACTCGTCTTTGCGAGCGCCGCTGAAG
CGCAGAGCATGACCACCAATGAGGTGAAGGGCACCAGTATTTCGAGGAAATGGCGCGGCACGGCCGGGTT
GGTGACGACTGGTCCCGACGGCAAGGTCATCTTCCTGTTCGGCGAGACGCAGCCGTCGGTCGTCTGCTCG
CCCTTGCAGGTCTGCGATATCGAGTTGCAGGGCGGCGAAATCGTGCGTGACGTTCTCGTTGGCGATAGCG
TGCGCTGGAAGGTCGAACCGGCGACCTCGGGTGCCACCGGCGGGCAGGCGATCCACCTGATCGTCAAGCC
GTCGGAGCCAGGCCTTGTCACCTCGATGGTGGTCACGACGTCGCGCCGCACCTATCACATCCAGCTGAAA
TCCCATCCGAGCCAGTATATGGCGCGCGTCGGTTTCGAGTATCCGGAGGACGTTTCGACGAAGCTTGCTG
ACATCAATTCAAGGCTCGAGACCGGCGGCATTCCAGGAACGGCACCCGACAAGCTGAACTTCTCCTACTC
GGTCAGCGGGAGCGCGCCGTGGAAGCCGAAACGGGTCTATTCGGACGGCGCAAAAACCTACGTCCAATTC
TCGAAATCGATCTCCGGACAGGACGCGCCGGTGCTTTTCGTCGTCAGCGGCGGCCAAAACCGCATCGTCA
ACTACCGCATGAACAATGACATGATGATCGTGGACTACGCGGTCGACAAGGCGATCCTCGTCTCCGGCGT
CGGCTGGCGGCAGCAGAAGATCACTATTCGGCGGGGAGGCTGA
 Primer design