SecReT4
Protein ID: 165932963
T4SS name [ID]VirB [486]
Gene symbolvirB8.1
Locus tagRrIowa_0464
StrainRickettsia rickettsii str. Iowa
Repliconchromosome [GenBank: NC_010263] [Browse all T4SS(s) in this replicon]
Location [Strand]389609..390307 [-]
Productchannel protein
Component typeVirB8
UniProt IDB0BWX0
KEGG IDrrj:RrIowa_0464
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.5e-17, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|165932963|ref|YP_001649752.1| channel protein [Rickettsia rickettsii str. Iowa]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPFSHRSLLLLICTIFTLLLTLVCININILLPINKKVNYL
IKDDAEKQAAITNTKHSTLVKPYTSIANIMLQNYVNQREEYNYDILKEQFTFIKNASTRIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSIKNINDNEAVVTFESLAKNSTGAILENMVWEARIGFIMDSISTNTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|319717301|ref|NC_010263.2|:c390307-389609 Rickettsia rickettsii str. Iowa chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTCAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAGTTTGTATAAATATCAACATATTGCTTCCTATAAATAAAAAAGTAAATTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTGCCATTACTAATACTAAACATTCAACATTAGTAAAGCCTTATA
CCTCTATTGCAAATATTATGCTTCAGAATTATGTAAACCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGCGTATTGTGTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAAAAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCACTGGCAAAAAATAGTACGGGTGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACCAATACATCACCT
GATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design