SecReT4
Protein ID: 165932965
T4SS name [ID]VirB [486]
Gene symbolvirB8.2
Locus tagRrIowa_0466
StrainRickettsia rickettsii str. Iowa
Repliconchromosome [GenBank: NC_010263] [Browse all T4SS(s) in this replicon]
Location [Strand]391001..391732 [+]
Productchannel protein
Component typeVirB8
UniProt IDB0BWX2
KEGG IDrrj:RrIowa_0466
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|165932965|ref|YP_001649754.1| channel protein [Rickettsia rickettsii str. Iowa]
MNNIFGFFKSSNNSQSGSGDTQTQESIKSANPLKMTQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEANTTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|319717301|ref|NC_010263.2|:391001-391732 Rickettsia rickettsii str. Iowa chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTTCAGGAGATACACAAACGC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATGACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTGCTTATCATATTAATAATACTACTAACCATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTGAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCAGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCAACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTTTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGCAAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCGGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design