SecReT4
Protein ID: 165932968
T4SS name [ID]VirB [486]
Gene symbolvirB11
Locus tagRrIowa_0469
StrainRickettsia rickettsii str. Iowa
Repliconchromosome [GenBank: NC_010263] [Browse all T4SS(s) in this replicon]
Location [Strand]393820..394824 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDB0BWX5
KEGG IDrrj:RrIowa_0469
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.1e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|165932968|ref|YP_001649757.1| type IV secretion system ATPase VirB11 [Rickettsia rickettsii str. Iowa]
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPELDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPNGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPSIERLITVEDAREVVLSRHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|319717301|ref|NC_010263.2|:393820-394824 Rickettsia rickettsii str. Iowa chromosome, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCTGGAGAAGTATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAACGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTTCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCACGTCATCCTAACAGAGTGCATTTG
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCCACACTGCATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGGGGATGGTTTAA
 Primer design